Details for Arabidopsis Locus AT3G10880

Position : Chr3 ( 5`- 3405815 .. 3407434 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10880

Protein [Map View]
MDLITETESENVDDSSLWLHNSKSLADILTEINQNVQQMLRMIEDSKPESTEKFLYLYQSLGETYNDLNQELLNGLLKLP
CSLVTSMGALSTFKPDKSPDLESGGTSYSSLNHQVVSTTSSEKSQSLKLNDEVEKKDSAFLLADMFCAELETARRELEAR
NIAIETEKRYVVDLESKLSDSVYKIEKLESELDEVKECLGVSEAEVSKLMEMLSECKNEKSKLQTDNADDLLDSLRAELR
SREIQIEQMEEYLNQVLCLNETEIKSESETDKNIVEELRAKVEVLEKQVELQRNVITEREEEKREAIRQLCFSLDHYMN*

DNA
ATGGATTTAATCACAGAAACAGAATCAGAGAATGTTGATGATTCTTCCTTGTGGCTCCATAATTCTAAGTCATTAGCAGA
CATATTAACAGAGATAAATCAGAATGTTCAACAAATGCTAAGAATGATTGAAGATAGCAAACCCGAGTCAACGGAGAAAT
TTCTTTACTTATATCAGTCGCTTGGTGAAACTTACAACGACTTGAACCAGGAGCTCCTCAACGGCCTTCTCAAACTGCCA
TGTTCTCTTGTAACTTCAATGGGTGCATTGAGCACCTTTAAGCCTGATAAGTCTCCTGATTTGGAGTCAGGAGGAACCTC
TTACTCATCTCTGAATCACCAAGTGGTCTCAACAACGAGTAGCGAAAAGTCGCAGAGCTTGAAACTAAATGATGAGGTTG
AGAAGAAAGACTCTGCATTTTTGCTTGCTGATATGTTTTGTGCTGAGCTTGAAACTGCACGGAGAGAACTAGAAGCTAGA
AACATAGCCATTGAAACTGAGAAAAGGTATGTGGTTGACTTAGAGAGTAAGCTATCAGATTCTGTTTACAAGATTGAGAA
ATTAGAAAGCGAGCTCGACGAGGTTAAAGAGTGTTTAGGTGTGTCAGAAGCAGAGGTTTCAAAGCTAATGGAAATGTTGA
GTGAATGCAAGAACGAGAAATCGAAACTGCAGACCGATAATGCTGATGACTTGTTAGATAGCCTAAGAGCAGAGTTGAGA
TCAAGAGAAATCCAGATTGAGCAAATGGAGGAGTATTTGAACCAGGTTTTGTGTCTTAATGAAACTGAGATTAAATCTGA
GTCAGAAACTGACAAGAATATTGTGGAAGAACTGAGAGCCAAAGTTGAAGTGTTGGAGAAACAAGTGGAGTTGCAGAGAA
ATGTGATAACAGAACGAGAGGAGGAGAAAAGAGAGGCTATAAGACAGCTCTGTTTCTCTCTGGATCATTACATGAACTGA