Details for Arabidopsis Locus AT3G10870

Position : Chr3 ( 5`- 3401078 .. 3402672 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10870

Protein [Map View]
MAEENQEETLELKPSRKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDSSSVDSLTTFDQYNQPLIDFL
SSFPEQEQVILVGHSAGGLSLTSAIQRFPKKICLAVFIGASMLKNGLQTDEDMKDGVPDLSEHGDVYELGFGLGPENPPT
SAIIKPEYRRKLLYHMSPQQECSLAALMMRPAPILALTTAKLEEEEKEKGQEEQVPRVYIKTLLDRVMKPEQQDAMIRRW
PPSQVYELESDHSPFFSNPFVLFGLLIKAAVSVGSI*

DNA
ATGGCGGAGGAGAATCAAGAAGAAACCCTAGAACTCAAACCAAGTAGAAAACCACCACACTTTGTGCTAATACATGGCAT
GAGCTTAGGATCATGGTGCTGGTACAAGATCAAATGTCTCATGGAAGTCTCTGGCTTCACCGTCACTTGCATCGACCTCA
AATCCTCCGGCATCGATTCTTCATCCGTGGATTCACTCACTACCTTCGACCAATACAACCAACCACTCATCGACTTCCTC
TCCTCTTTCCCCGAACAAGAACAGGTGATACTTGTGGGTCACAGTGCAGGAGGGCTTAGCCTAACGAGTGCGATACAGAG
ATTCCCTAAGAAGATCTGTCTCGCTGTTTTTATTGGAGCTTCGATGCTCAAAAACGGGCTTCAGACAGATGAAGATATGA
AAGATGGAGTGCCTGATCTATCAGAACATGGTGATGTCTACGAGCTTGGTTTTGGTCTAGGACCGGAGAATCCTCCCACC
AGTGCTATTATCAAACCTGAATACCGACGAAAACTACTTTACCACATGAGTCCTCAACAGGAATGTTCCTTGGCTGCATT
AATGATGAGACCAGCACCAATTTTGGCGTTAACGACAGCAAAACTGGAAGAAGAGGAAAAAGAAAAAGGACAAGAGGAGC
AAGTGCCGCGCGTGTACATCAAGACGTTACTCGACCGGGTCATGAAACCGGAGCAGCAAGACGCGATGATAAGACGGTGG
CCACCTAGCCAAGTTTACGAATTGGAGAGCGACCATTCTCCTTTCTTCTCTAACCCTTTTGTTCTCTTTGGTTTACTCAT
CAAAGCTGCCGTTTCCGTCGGTTCTATCTAA