Details for Arabidopsis Locus AT3G10860

Position : Chr3 ( 5`- 3399736 .. 3400741 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10860

Protein [Map View]
MGKQPVKLKAVVYALSPFQQKIMTGLWKDLPEKIHHKVSENWISATLLVTPVVGTYWYAQYFKEQEKLEHRF*

DNA
ATGGGGAAGCAGCCGGTGAAATTGAAGGCGGTGGTTTACGCACTTTCTCCGTTTCAGCAGAAGATCATGACCGGTCTCTG
GAAGGATCTGCCGGAGAAGATCCACCACAAGGTCTCTGAGAATTGGATCAGCGCCACTCTTCTCGTTACCCCTGTCGTTG
GAACCTACTGGTATGCTCAGTATTTCAAGGAACAGGAGAAGCTTGAGCACAGATTCTGA