Details for Arabidopsis Locus AT3G10850

Position : Chr3 ( 5`- 3397549 .. 3399574 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10850

Protein [Map View]
MKIFHVPCLQDNYSYLIIDESTGDAAVVDPVDPEKVIASAEKHQAKIKFVLTTHHHWDHAGGNEKIKQLVPDIKVYGGSL
DKVKGCTDAVDNGDKLTLGQDINILALHTPCHTKGHISYYVNGKEGENPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVT
LAALPKPTQVYCGHEYTVKNLEFALTVEPNNGKIQQKLAWARQQRQADLPTIPSTLEEELETNPFMRVDKPEIQEKLGCK
SPIDTMREVRNKKDQWRG*

DNA
ATGAAGATCTTCCACGTTCCTTGTCTGCAAGACAACTACTCTTATCTGATAATCGATGAGAGCACCGGAGACGCGGCGGT
TGTGGATCCAGTTGATCCGGAGAAGGTGATCGCATCGGCTGAGAAGCACCAAGCTAAGATCAAGTTCGTACTCACTACGC
ATCATCACTGGGATCATGCCGGTGGAAACGAGAAGATTAAGCAGTTGGTTCCTGATATCAAAGTATATGGAGGTTCTCTG
GATAAGGTGAAGGGTTGCACTGATGCGGTTGATAATGGTGACAAGCTGACTTTGGGTCAGGATATTAACATATTGGCTCT
CCACACTCCTTGTCACACCAAGGGTCACATTAGTTATTATGTGAACGGAAAAGAAGGAGAAAACCCAGCCGTGTTCACCG
GAGATACACTTTTTGTTGCTGGATGTGGGAAGTTTTTTGAAGGGACAGCTGAGCAGATGTATCAGTCGTTGTGTGTGACT
CTGGCTGCATTACCTAAACCGACACAGGTTTACTGCGGCCATGAGTACACCGTTAAGAACTTGGAATTTGCTCTAACTGT
GGAACCAAACAACGGGAAGATACAACAGAAGTTAGCATGGGCCCGTCAACAGCGCCAAGCAGATCTTCCCACAATCCCTT
CAACACTGGAGGAAGAGCTCGAAACAAATCCATTTATGCGTGTTGATAAGCCAGAGATACAGGAGAAACTCGGTTGCAAG
TCGCCAATTGATACAATGAGGGAAGTTCGGAACAAGAAGGATCAGTGGAGGGGATGA