Details for Arabidopsis Locus AT3G10820

Position : Chr3 ( 5`- 3387200 .. 3391003 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10820

Protein [Map View]
MAKMRPSVSLDTWREYFRRGDSDIFGIIDHAIMVAAADWPKEFKSRSDRIAELLFSCKVSRCIGCDHLELSIAGDEAAVE
IVGVGGGGDRGDSGVATGEGEEASVSVDEVMRIRDILSNKDDEKDSVLLESLRKLESMSMSVDILKDTEIGKAVNGLRRH
SSDKISKLAKTLFAEWKRLVDQWMNTPEEMAGTEGTPESLNLSVIDEEEAFPSPPHDLDIYAPEPNGFELSQILDCLDCD
GNPRHSVESKHERKSQSSAGRRPKGTNDANVVGRYCNDQQTRREEADVRPMKHSATDVVEPKRQTKQSREQMVSAIQRKP
TAVTEQKRKLAGPQQDKLKALDPDSKFEFAKRKLQESYHQHENAKRQRTIQVLETIPKQNKVQKPQLKRPATRRYIYWYF
WSSEFPGYELPSLILNLANPRDSSSQFSRHDELMIDIPVYFGLVLVQIDKAEMVDEMMIFKKMSVLLTEKDFVDAIVSVS
LKDLTRSLFVRFEAKACPKFDLIHKTSVETVRCVGKTFMHMLSKVSREFPPRNRTHPGGLLYQRFDPTHLSLARQQVAIC
KETDSQYPHEIVIHWTSASA*

DNA
ATGGCGAAGATGAGACCATCTGTTTCGTTGGATACTTGGAGAGAGTATTTCCGGCGAGGAGATTCTGATATTTTTGGTAT
CATTGATCATGCGATTATGGTAGCTGCTGCAGATTGGCCAAAGGAGTTTAAATCCAGGAGTGATAGAATTGCTGAGCTTC
TCTTCTCTTGTAAAGTGAGTCGCTGCATTGGTTGTGACCACCTTGAGCTCTCGATAGCTGGAGACGAAGCGGCGGTGGAG
ATAGTTGGAGTTGGCGGCGGCGGTGATAGGGGTGATTCTGGTGTTGCGACGGGTGAAGGTGAAGAGGCGTCTGTGAGTGT
TGATGAGGTTATGAGGATCAGAGATATCTTGTCGAACAAAGACGATGAGAAAGATTCTGTGTTACTCGAATCTCTGAGAA
AGCTTGAGTCAATGTCTATGAGTGTGGACATTCTTAAGGATACTGAAATTGGAAAGGCTGTTAATGGTCTGAGGAGACAT
AGTTCCGATAAGATTAGCAAACTTGCAAAGACTCTTTTCGCAGAGTGGAAGAGGCTGGTGGACCAGTGGATGAACACCCC
AGAGGAAATGGCTGGCACTGAAGGGACGCCAGAGTCTCTAAACCTTTCAGTAATTGATGAAGAAGAAGCCTTTCCTTCTC
CTCCACATGATTTAGATATCTATGCACCTGAACCTAATGGGTTTGAACTTTCTCAGATCTTAGATTGTTTGGACTGCGAT
GGAAATCCTCGTCACAGTGTGGAGTCCAAACATGAAAGAAAATCGCAAAGTAGTGCGGGGAGGAGACCCAAGGGAACAAA
TGATGCAAATGTGGTTGGGAGGTACTGCAATGATCAACAGACGAGGAGAGAAGAAGCTGATGTTAGACCTATGAAGCACT
CAGCCACAGATGTTGTCGAGCCTAAAAGACAAACAAAGCAAAGTAGAGAACAAATGGTATCCGCAATCCAACGAAAACCA
ACTGCTGTTACTGAGCAAAAGCGGAAACTTGCTGGACCTCAACAAGATAAACTCAAAGCTCTGGATCCAGACTCAAAGTT
TGAGTTTGCAAAGCGGAAACTCCAAGAGAGCTACCACCAACATGAGAATGCTAAGAGACAGAGGACGATACAAGTACTGG
AAACTATCCCAAAGCAAAATAAAGTTCAGAAACCGCAACTCAAGAGACCCGCCACACGAAGATATATTTATTGGTACTTC
TGGTCCAGTGAATTCCCGGGTTACGAGTTACCTTCCCTCATCCTCAATCTCGCGAATCCTCGTGATAGTTCCTCCCAATT
CTCAAGACATGATGAGTTGATGATTGATATTCCTGTATATTTTGGACTCGTACTTGTGCAGATAGATAAAGCAGAGATGG
TGGATGAGATGATGATTTTCAAGAAGATGAGTGTCCTTCTAACTGAAAAGGATTTTGTTGATGCCATCGTATCTGTTTCT
CTCAAGGACCTTACGAGATCACTCTTTGTCAGGTTCGAGGCCAAGGCTTGCCCTAAGTTTGACCTTATCCATAAGACTTC
CGTCGAGACGGTTAGGTGCGTAGGGAAAACCTTTATGCATATGCTCTCTAAGGTTTCTAGAGAGTTTCCTCCCCGCAATC
GAACTCATCCCGGTGGCCTCCTCTATCAGCGATTTGATCCTACTCACTTGTCTCTTGCTCGCCAACAAGTTGCTATATGC
AAGGAAACTGATTCACAGTATCCGCATGAGATTGTGATTCACTGGACAAGTGCAAGCGCCTGA