Details for Arabidopsis Locus AT3G10815

Position : Chr3 ( 5`- 3384807 .. 3386327 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10815

Protein [Map View]
MTTTRRKNTHWCHTCRRGIHLQGEGRREGACIYCGNTFLERLYENVELSPFDLFGLAYEEARNRRNNRRSVIGEQLSFEE
LFNRLPALQDRRGPPPASLAAINSLQKIKIRQKHLGLDPYCPVCQDQFEIGSDARKMPCKHIYHSECILPWLVQRNTCPV
CRKELPQDRNNSRKNPLWHLWPFRSSGLASNHNGSSPFH*

DNA
ATGACTACGACTAGGCGGAAAAATACACATTGGTGTCATACTTGTAGACGAGGAATCCATCTTCAAGGAGAAGGCAGAAG
AGAAGGAGCTTGCATTTACTGTGGTAACACCTTTCTTGAAAGGCTATATGAGAATGTTGAACTAAGCCCTTTTGATTTAT
TCGGATTAGCCTACGAAGAAGCTCGTAACCGTCGCAACAACAGAAGATCGGTTATAGGAGAACAACTAAGTTTTGAAGAG
TTGTTTAACCGGCTCCCAGCACTACAAGACCGTCGTGGTCCTCCTCCAGCATCACTAGCCGCGATTAACTCATTGCAAAA
GATCAAAATCAGGCAGAAGCATCTCGGTTTAGATCCCTATTGTCCGGTTTGCCAAGACCAGTTTGAAATCGGATCAGATG
CAAGAAAAATGCCGTGTAAACATATCTACCATTCTGAATGTATACTCCCGTGGTTAGTCCAGCGTAATACTTGCCCCGTC
TGCCGCAAAGAACTTCCACAAGACCGAAATAATAGCCGGAAAAATCCATTGTGGCATCTGTGGCCGTTCAGGTCCTCTGG
TTTGGCCTCAAACCATAATGGATCATCACCTTTCCATTGA