Details for Arabidopsis Locus AT3G10810

Position : Chr3 ( 5`- 3381848 .. 3384509 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10810

Protein [Map View]
MGKTEDDVSLRVAGGEATGDSTVRNARCGCCKWISSFVGFKCLFVLLLSVALFLSALFLLLPFPMDREDSNLDPRFRGHA
IVASFSINRSASFLNENTLQLQNDIFQEMSYISIKVTILAVEPSDELNITKVVFGIDPDTGYREILPLSLSSIKEMFESV
LINQSTLQLTKSLFGETFLFEVLKFPGGITVIPPQSAFPLQKFKIVFNFTLNYSIHQIQINFNTLASQLKNGLNLAPYEN
LYVSLSNSEGSTVSPPTTVHSSVLLRVGTSNSSPRLKQLTDTITGSRSKNLGLNNTIFGKVKQVRLSSFLPNSSDSSTKS
PSPSPSPHSKHHHHHHHHHHHHHHHHHNHHHHHHHNLSPKMAPEVSPVASPAPHRSRKRAPSAPPPCNPGNRVHFKEKRV
QFSSTPAPAPSAGAPHHQLHSPAPISAAKSHIVPISAPLPHVVFAHAAQPPITEPREPHANEVAHPQPQSSSSAIEVLPA
MPWIVLLMLIVAWLHE*

DNA
ATGGGTAAAACCGAGGATGATGTGAGTCTCCGTGTCGCCGGCGGCGAAGCTACCGGCGATTCGACGGTGAGGAATGCTCG
GTGTGGGTGTTGCAAATGGATCTCAAGCTTCGTTGGGTTCAAATGTTTATTCGTGCTGCTTTTATCAGTCGCTTTGTTTC
TTTCGGCTTTGTTTTTGTTGCTTCCGTTTCCTATGGATCGTGAGGATTCGAATCTTGATCCCAGATTTAGAGGTCATGCT
ATAGTGGCCAGTTTTAGCATCAATAGATCGGCTTCTTTTCTTAATGAAAATACATTGCAGCTTCAGAATGACATCTTTCA
AGAGATGAGCTACATTTCCATCAAAGTAACTATCCTGGCTGTTGAGCCGTCAGATGAATTGAACATAACAAAGGTTGTGT
TTGGAATTGACCCTGATACTGGATACCGAGAAATCTTACCTCTGTCCCTGAGTTCTATCAAAGAGATGTTTGAATCGGTG
CTCATAAATCAATCTACTCTCCAGCTTACAAAATCCTTGTTTGGGGAAACCTTCCTTTTTGAAGTGCTAAAATTTCCAGG
AGGAATCACTGTGATTCCACCACAAAGTGCTTTCCCTCTGCAGAAATTCAAGATTGTTTTCAACTTTACCCTAAACTACT
CTATTCACCAGATACAGATAAACTTCAATACCCTTGCTAGTCAACTCAAAAATGGGCTGAATCTCGCACCATACGAGAAT
TTGTATGTAAGCTTATCGAACTCAGAAGGGTCGACCGTGTCTCCCCCGACAACTGTTCACTCATCAGTTTTGCTAAGAGT
CGGGACTTCAAATTCAAGCCCAAGGTTGAAACAACTGACTGATACCATCACAGGTTCACGCTCGAAAAACCTTGGCCTGA
ATAATACCATATTTGGTAAGGTCAAGCAAGTTCGTCTGTCATCTTTCTTGCCAAACAGCAGTGATAGTAGCACCAAATCT
CCATCACCCTCACCTAGTCCCCATTCGAAGCATCACCATCACCATCACCATCACCATCACCACCACCACCATCACCATCA
CAACCATCATCACCACCACCACCACAATCTTAGCCCGAAAATGGCTCCCGAGGTTTCACCTGTGGCCTCTCCTGCTCCTC
ACAGAAGCCGTAAGAGAGCTCCATCTGCACCTCCACCCTGCAACCCAGGGAATAGAGTACATTTCAAGGAGAAACGCGTG
CAGTTTTCATCCACACCTGCGCCTGCTCCTTCTGCTGGGGCACCACATCATCAGCTGCACTCACCGGCCCCAATTTCTGC
AGCCAAGTCTCATATAGTTCCAATCTCTGCCCCTCTACCACATGTGGTGTTTGCCCATGCAGCTCAACCACCCATAACGG
AACCACGGGAACCACATGCAAACGAAGTTGCTCATCCTCAACCGCAGTCCTCTTCATCAGCGATTGAGGTTTTACCAGCT
ATGCCATGGATTGTCCTTCTCATGCTGATAGTGGCCTGGCTTCATGAATAA