Details for Arabidopsis Locus AT3G10790

Position : Chr3 ( 5`- 3377410 .. 3378369 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10790

Protein [Map View]
MEEVKGKRTISNTWKLVTRSQTDPFEGMPLHLKEKILMKLKAKIISTFILLSKSWSSIVLNKDFTNMYLIIKFFESLNRP
RLLLAVDDREINMQFFHSCSREDPSSDHQTVGCYPDSYPRIWYDFSPPVRGLICCLNNSTKVVIGNPTTCQFETLPRVRT
KIYQEIFPFFGYDHVKDEYKVLCMTISDEYYSRSGNIVSKEHKVFTLGCKQKKWRMIECTINHYLTPGTQGIFSNGVIYY
FARVNDDQSLMCFVVGSEKFSVVELPRPAVEVLANYGEKIAVTNLLYASNDRLFVWILEDASKQEWSNFCVLVPSWVDI*

DNA
ATGGAAGAGGTAAAGGGGAAAAGAACCATCAGTAACACTTGGAAACTTGTTACAAGGTCCCAAACTGACCCCTTTGAAGG
AATGCCTCTGCATCTGAAAGAGAAGATTCTCATGAAATTGAAGGCCAAAATCATATCGACGTTCATCCTCCTTTCCAAGT
CCTGGTCATCGATAGTCCTTAACAAAGATTTCACCAACATGTATTTGATAATAAAGTTCTTTGAATCTTTGAATCGACCA
CGTCTTCTTTTGGCAGTCGACGATCGAGAAATAAATATGCAGTTCTTCCACTCTTGCTCTCGAGAGGATCCATCTTCTGA
TCATCAAACGGTTGGCTGTTACCCTGATTCGTATCCGCGTATCTGGTATGACTTTTCTCCACCTGTTCGTGGCTTGATCT
GCTGTCTAAACAATTCTACTAAAGTGGTAATTGGAAATCCTACTACTTGTCAATTTGAAACTTTACCGAGAGTCAGAACC
AAAATATACCAAGAAATATTTCCCTTCTTTGGATACGATCATGTTAAGGATGAATACAAAGTCTTGTGCATGACGATATC
GGATGAGTACTATAGTAGATCAGGAAATATTGTGTCCAAGGAGCATAAAGTTTTCACTCTAGGATGTAAACAGAAGAAAT
GGAGAATGATCGAATGTACGATTAATCATTATCTTACTCCTGGAACTCAAGGAATATTTAGCAATGGGGTTATCTATTAC
TTCGCTAGGGTCAATGATGATCAGTCGCTAATGTGCTTTGTTGTGGGGTCTGAAAAGTTTAGTGTCGTTGAGTTACCGAG
GCCGGCCGTCGAAGTTCTAGCGAACTACGGCGAAAAGATAGCTGTAACGAATTTGTTATATGCTAGTAATGATAGACTTT
TTGTATGGATTCTAGAAGATGCCAGCAAACAAGAATGGTCAAACTTTTGTGTCTTGGTTCCTTCTTGGGTAGATATATAG