Details for Arabidopsis Locus AT3G10770

Position : Chr3 ( 5`- 3372264 .. 3374271 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10770

Protein [Map View]
MASMTEKEAMVDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFPPFPTSYLRLAAHRVAQHYGLVTMALDNGTG
AGDGSDNRILVTKTAESRFPYVCLSEIPVKQPENGRPEGFKIAIKPRPKRGSGCGGSGSGVQQNLLRSVEERKEEYDKAR
ARIFNSPSSSDSEDSSSLRPPSLEVRNTCINRNETEVAVNNSPVDAVTRDSGRTSRVAIIRDREKDRYDPDYDRSYDRYV
VDPAYRYVRVMPSGQSFSPMPIHIPFHDGFFPHMPRGHQANLNYGHPLNPALSPFTHNVASYTPWPNSPVMNYAQPLNGS
DTNLYRYPSASNP*

DNA
ATGGCTTCTATGACCGAGAAGGAAGCTATGGTGGATCCTTTTCTGGTCGAGGCTCTTCAAAATCCTCGTCATCGTCTCAC
CATTTTGCGAATGGAGCTTGATATACAGAAGTTCTTTCAAAACCCTGAGCAGCTTCAGTTCGAATTCCCGCCTTTTCCAA
CATCGTACCTGCGTCTTGCTGCACATCGAGTTGCTCAGCATTATGGACTAGTAACCATGGCTTTGGACAATGGTACTGGT
GCAGGAGATGGATCCGATAACAGAATCCTCGTGACGAAGACAGCGGAAAGTAGATTTCCTTATGTCTGCTTATCCGAAAT
CCCTGTGAAACAACCTGAGAATGGTAGACCCGAGGGTTTCAAAATCGCTATCAAGCCTAGACCCAAGAGAGGATCTGGTT
GTGGGGGTAGCGGATCAGGAGTACAGCAGAATCTTTTGAGAAGTGTTGAGGAGAGAAAGGAAGAGTATGATAAAGCTCGC
GCTCGGATCTTTAATAGTCCTAGCAGTTCCGACTCTGAAGATTCTTCATCACTACGACCTCCCTCTCTTGAAGTGAGAAA
CACATGTATAAACCGGAATGAGACTGAAGTGGCGGTTAATAATAGTCCTGTCGATGCTGTTACTCGAGACTCTGGACGGA
CTTCTCGAGTAGCCATTATCAGAGATAGAGAGAAAGATCGATATGACCCGGATTATGACAGGAGCTATGACAGGTATGTC
GTGGATCCGGCCTACAGGTACGTTAGGGTTATGCCGTCTGGCCAAAGCTTCAGTCCAATGCCAATCCATATTCCGTTTCA
CGATGGGTTTTTCCCGCATATGCCAAGAGGTCATCAAGCCAACCTAAACTATGGGCATCCGCTTAACCCTGCTTTGAGTC
CCTTTACTCATAACGTGGCTTCATATACACCGTGGCCAAACTCACCCGTTATGAACTATGCACAGCCGTTGAACGGCTCA
GACACAAATCTTTACAGGTATCCTTCTGCAAGTAATCCCTGA