Details for Arabidopsis Locus AT3G10760

Position : Chr3 ( 5`- 3369580 .. 3371227 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10760

Protein [Map View]
MREDDSDWFARWEEELPSPEELMPISQSLISPDLALAFDIRTPNHGNGNSNQPHHHHHHQTTPPTPSQLQLPSSQANSSA
EFAADSADLGSGGAAGDEPARTLKRPRLVWTPQLHKRFVDAVAHLGIKNAVPKTIMQLMSVDGLTRENVASHLQKYRLYL
KRMQGLSSGGGAGSDPATDRLFASSPVPAHFLHPNRVPSSDHFMPSFVPIATLQQQQQMAAAAAAAAAANPHLQPPQFHR
QIAAAHFGSPTNGGFSSPTSNGQFGSPTSNGFGSPTTNGKFDPSFLAVRQTQQQPIQRMSTPSLHSPVSNYVEDLESANA
NGGRTVLTLFPTRDD*

DNA
ATGAGAGAAGACGATTCAGACTGGTTCGCAAGATGGGAAGAAGAACTTCCATCACCAGAAGAGCTCATGCCAATATCACA
ATCTCTAATCTCACCCGATCTAGCTCTAGCCTTCGATATACGAACCCCAAATCACGGAAACGGAAACTCAAACCAACCTC
ATCATCATCATCATCACCAAACCACACCTCCTACACCGTCTCAGCTTCAGCTTCCATCTTCTCAAGCCAATTCCTCAGCC
GAATTCGCTGCAGATTCAGCAGATCTAGGCTCCGGAGGAGCTGCCGGAGACGAACCAGCTCGGACTTTAAAACGACCTCG
TCTTGTCTGGACACCGCAGCTGCATAAACGTTTCGTTGATGCTGTTGCGCATTTAGGGATTAAGAACGCAGTTCCTAAAA
CGATTATGCAGCTTATGAGTGTTGATGGTTTAACTAGAGAAAACGTTGCGAGTCATTTGCAAAAGTATAGACTTTATCTT
AAGAGAATGCAAGGTTTGTCTTCTGGTGGTGGTGCTGGTTCAGATCCAGCTACTGATCGTCTTTTCGCTAGCTCTCCTGT
TCCTGCTCACTTTCTTCATCCTAATCGTGTTCCCAGTTCTGATCATTTCATGCCGTCTTTTGTTCCTATTGCTACTCTTC
AACAACAACAACAAATGGCTGCTGCTGCGGCCGCTGCTGCAGCAGCTAATCCTCATTTACAACCGCCTCAGTTCCACCGT
CAAATCGCAGCTGCGCATTTTGGTTCACCGACTAATGGTGGATTCAGTTCACCGACGAGTAATGGACAGTTTGGATCACC
GACTAGTAATGGATTTGGATCACCGACGACTAATGGGAAGTTTGATCCTTCGTTCTTGGCGGTGAGGCAAACGCAGCAGC
AACCAATTCAGAGAATGTCTACACCATCATTGCATAGTCCAGTTAGTAATTACGTTGAGGATTTGGAATCTGCAAACGCT
AATGGAGGGAGAACTGTCTTAACTTTATTCCCAACTCGAGACGATTAA