Details for Arabidopsis Locus AT3G10710

Position : Chr3 ( 5`- 3352289 .. 3354237 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10710

Protein [Map View]
MSSPYGKVDEREHVRLEARRKTRKNIAIIAVSLVILAGIVIGAVFGTMAHKKSPETVETNNNGDSISVSVKAVCDVTLHK
EKCFETLGSAPNASSLNPEELFRYAVKITIAEVSKAINAFSSSLGDEKNNITMNACAELLDLTIDNLNNTLTSSSNGDVT
VPELVDDLRTWLSSAGTYQRTCVETLAPDMRPFGESHLKNSTELTSNALAIITWLGKIADSFKLRRRLLTTADVEVDFHA
GRRLLQSTDLRKVADIVVAKDGSGKYRTIKRALQDVPEKSEKRTIIYVKKGVYFENVKVEKKMWNVIVVGDGESKSIVSG
RLNVIDGTPTFKTATFAVFGKGFMARDMGFINTAGPSKHQAVALMVSADLTAFYRCTMNAYQDTLYVHAQRQFYRECTII
GTVDFIFGNSASVLQSCRILPRRPMKGQQNTITAQGRTDPNMNTGISIHRCNISPLGDLTDVMTFLGRPWKNFSTTVIMD
SYLHGFIDRKGWLPWTGDSAPDTIFYGEYKNTGPGASTKNRVKWKGLRFLSTKEANRFTVKPFIDGGRWLPATKVPFRSG
L*

DNA
ATGTCCTCTCCTTACGGCAAAGTCGACGAGCGTGAACATGTAAGGCTCGAAGCTCGTCGTAAGACGAGAAAGAACATCGC
AATCATCGCTGTATCACTAGTCATTCTTGCCGGAATCGTGATCGGAGCTGTGTTTGGAACCATGGCTCACAAGAAGTCAC
CAGAGACAGTGGAGACTAATAACAACGGAGACTCAATCTCCGTTTCCGTTAAAGCCGTTTGCGACGTTACGTTGCATAAA
GAAAAATGCTTCGAAACCCTCGGATCAGCTCCAAACGCAAGCAGTCTCAATCCAGAAGAGCTCTTCAGATACGCAGTCAA
AATCACAATCGCCGAAGTTTCAAAAGCTATCAACGCTTTCTCTTCATCCTTAGGCGATGAAAAGAACAACATCACCATGA
ACGCTTGCGCTGAGCTTCTTGACCTAACGATAGATAACCTCAACAACACGTTAACCTCATCATCAAACGGTGATGTCACG
GTTCCTGAGCTAGTCGATGATCTCCGTACATGGCTGAGTTCAGCCGGGACGTATCAACGGACGTGCGTGGAAACGTTGGC
TCCAGATATGAGGCCGTTCGGCGAAAGTCATCTCAAGAACTCAACGGAGTTGACGAGTAACGCACTAGCGATCATCACAT
GGCTCGGGAAGATCGCTGACTCTTTCAAACTCCGGAGGCGTTTGTTAACAACTGCAGACGTGGAGGTGGACTTCCACGCG
GGTCGGAGATTGTTGCAGAGCACGGATTTGAGGAAAGTGGCGGATATTGTGGTGGCGAAGGATGGTTCAGGGAAGTATAG
AACGATAAAGAGGGCTTTACAAGATGTGCCAGAGAAGAGTGAGAAGAGGACGATTATATATGTGAAGAAAGGAGTTTATT
TTGAGAATGTGAAGGTGGAGAAGAAGATGTGGAATGTTATTGTGGTTGGAGATGGCGAGAGCAAGAGTATTGTCTCTGGT
AGACTTAATGTCATCGATGGAACTCCCACTTTTAAGACCGCCACATTCGCTGTGTTTGGAAAAGGGTTTATGGCAAGAGA
CATGGGCTTCATCAACACAGCTGGTCCATCCAAACATCAAGCTGTTGCTCTAATGGTAAGCGCAGATCTCACAGCATTTT
ACCGTTGCACGATGAACGCATACCAAGACACGCTTTACGTTCATGCACAACGCCAATTCTACCGTGAATGCACCATTATC
GGAACAGTAGATTTCATCTTTGGTAACTCAGCTTCAGTTCTCCAAAGCTGCCGGATTCTCCCTCGCCGACCAATGAAAGG
ACAACAAAACACAATCACGGCTCAAGGACGTACTGATCCGAACATGAACACAGGAATCTCGATTCACCGTTGTAACATCT
CTCCACTCGGTGACCTAACCGATGTTATGACGTTTCTAGGTCGACCATGGAAGAATTTCTCGACGACGGTTATAATGGAC
TCGTATTTGCATGGTTTTATTGACCGGAAAGGCTGGTTACCGTGGACCGGAGATTCTGCGCCGGATACTATATTTTACGG
TGAGTATAAGAATACCGGTCCTGGTGCATCGACGAAGAATAGGGTTAAGTGGAAGGGTTTGAGGTTTCTTAGTACGAAGG
AAGCGAATAGGTTTACGGTGAAACCTTTCATCGACGGTGGAAGATGGCTTCCGGCGACGAAAGTGCCGTTCAGGTCCGGT
CTCTGA