Details for Arabidopsis Locus AT3G10700

Position : Chr3 ( 5`- 3346578 .. 3351023 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10700

Protein [Map View]
MSWPTDSELNSIKEAVAQMSGRDKGEVRVVVAPYRICPLGAHIDHQGGTVSAMTINKGILLGFVPSGDTQVQLRSAQFEG
EVCFRVDEIQHPIGLANKNGASTPSPSKEKSIWGTYARGAVYALQSSKKNLKQGIIGYLSGSNGLDSSGLSSSAAVGVAY
LLALENANELTVSPTENIEYDRLIENGYLGLRNGILDQSAILLSNYGCLTYMDCKTLDHELVQAPELEKPFRILLAFSGL
RQALTTNPGYNLRVSECQEAAKVLLTASGNSELEPTLCNVEHAVYEAHKHELKPVLAKRAEHYFSENMRVIKGREAWASG
NLEEFGKLISASGLSSIENYECGAEPLIQLYKILLKAPGVYGARFSGAGFRGCCLAFVDAEKAEAAASYVKDEYEKAQPE
FANNLNGGKPVLICEAGDAARVLL*

DNA
ATGTCTTGGCCTACGGATTCTGAGTTAAATTCCATAAAGGAGGCAGTGGCTCAGATGAGTGGAAGAGATAAAGGAGAAGT
TCGAGTGGTGGTCGCTCCTTATCGTATATGTCCTTTAGGAGCTCACATTGATCACCAGGGTGGAACTGTATCAGCTATGA
CGATTAATAAAGGGATCCTTCTTGGTTTTGTTCCATCGGGTGATACTCAGGTCCAGTTGCGCTCTGCACAATTTGAAGGA
GAAGTATGTTTCAGAGTAGATGAAATCCAGCACCCAATAGGCCTAGCAAACAAGAATGGTGCAAGCACGCCATCTCCATC
GAAGGAAAAAAGTATCTGGGGTACTTATGCCAGAGGAGCAGTTTATGCGTTACAGAGCAGCAAAAAGAATCTCAAACAGG
GCATTATTGGTTACCTCAGTGGCTCAAATGGACTAGATAGCTCCGGGCTTAGCTCATCAGCTGCTGTTGGTGTGGCATAC
CTGCTAGCTCTAGAGAATGCAAACGAATTGACTGTATCCCCAACAGAAAATATCGAATATGACAGGCTTATTGAGAATGG
GTATCTGGGTCTGCGGAATGGAATTTTGGATCAATCAGCTATTTTGCTTTCGAATTATGGGTGTCTAACATACATGGACT
GCAAGACTTTGGACCACGAGCTTGTACAGGCTCCTGAACTGGAGAAACCGTTCAGGATATTGTTAGCATTCTCAGGCTTG
AGGCAGGCGTTGACCACCAACCCAGGATATAATCTGCGAGTTTCTGAGTGTCAAGAGGCAGCAAAAGTTCTTTTGACTGC
ATCTGGGAACAGTGAGCTGGAACCTACGTTGTGCAATGTTGAGCATGCGGTCTATGAAGCTCACAAGCATGAGCTGAAAC
CGGTTTTAGCTAAAAGAGCAGAGCATTATTTCTCGGAGAACATGCGAGTTATCAAAGGACGGGAAGCCTGGGCTTCAGGG
AATCTTGAAGAATTTGGAAAGCTAATTTCAGCATCCGGCTTGAGTTCCATTGAGAATTACGAATGCGGTGCGGAGCCACT
GATCCAGCTATACAAGATTCTTCTGAAGGCTCCTGGTGTATATGGAGCTAGATTCAGCGGTGCAGGTTTCAGGGGATGTT
GTCTAGCCTTTGTAGATGCAGAAAAAGCTGAGGCAGCTGCTTCATATGTGAAGGATGAATATGAAAAGGCCCAACCCGAG
TTTGCTAACAATCTAAATGGAGGAAAACCTGTTCTCATCTGTGAAGCAGGTGACGCTGCTCGTGTTCTTCTCTGA