Details for Arabidopsis Locus AT3G10680

Position : Chr3 ( 5`- 3337773 .. 3339345 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10680

Protein [Map View]
MAAIFKRPRPGGGRHPPPLAPTVSSFKPRAQWTNSGSSIFLYVNLPGFYRDQIEIKKDERTRTVQIQGQRPLSAQTKARF
SEAYRVPDTCDMTKLSTSFSHGLLTIEFPAIVEANKQEKAVQDQEKIGQRSNQEKSGGPGPNGSTLGRKKALEEEKQVGT
SQEKTTPTLNEEAPKTYKSVVEGKRAVPTGSQEKSEAKVKAREAIPSLGGRERAKEEKVVERKEAAHIVQQKIGDKLKEE
EAKSTPTLGGSLKPKVQAKEEKVIERKKDDDISQLKTGQKVKEKEISRTPTIDARVESKEHAKVVEKKEDGEIGQKLEGG
RINLGPKKEDKFTKPVVGDEARRIEKNVAQRNQAEPKLKTKEGDERIKLDVDDGVRNKQDENNEMVGDMVSEGEIQDRVE
QKKIDEAGLAKDRGDLKDNAEVVEPETGPLLVKEGQKKSDMDPPLAVGGRGMGEEESRTYDIPLVNVGVAALVIMGFGAY
VFVPLVKYFS*

DNA
ATGGCGGCGATTTTCAAGAGACCAAGGCCGGGAGGTGGCCGTCATCCGCCACCGCTGGCTCCGACAGTGAGTAGTTTCAA
GCCGAGAGCTCAATGGACTAACTCCGGATCTTCCATTTTCCTCTACGTTAATCTTCCTGGGTTTTATAGGGATCAAATAG
AAATAAAAAAGGATGAGAGGACAAGGACTGTCCAGATTCAAGGCCAGCGACCGCTCTCTGCTCAGACTAAGGCTCGTTTC
AGTGAAGCTTACCGTGTCCCTGATACCTGTGACATGACCAAATTGAGCACCTCCTTCTCACATGGACTCTTGACCATCGA
GTTTCCAGCAATCGTGGAAGCTAACAAACAGGAGAAAGCAGTCCAAGATCAGGAGAAGATTGGACAGAGGTCTAATCAGG
AGAAAAGTGGAGGGCCTGGTCCTAATGGGAGTACCTTGGGACGAAAGAAAGCTTTGGAGGAGGAGAAACAAGTGGGAACA
AGTCAAGAGAAAACCACTCCAACGTTGAATGAAGAAGCACCCAAAACGTATAAATCAGTGGTTGAGGGTAAAAGAGCAGT
GCCAACGGGCAGTCAAGAGAAGTCTGAAGCGAAAGTTAAAGCGCGAGAGGCAATCCCTAGCTTAGGGGGAAGAGAACGTG
CGAAAGAAGAGAAGGTGGTTGAGAGAAAGGAGGCTGCTCACATAGTTCAGCAAAAGATAGGAGATAAATTGAAGGAGGAA
GAGGCTAAAAGTACACCAACCCTTGGTGGTAGCTTAAAACCTAAGGTACAGGCAAAAGAAGAGAAAGTAATTGAGAGAAA
GAAAGATGATGATATAAGTCAGCTTAAGACTGGACAGAAGGTGAAGGAAAAAGAGATTAGCAGAACGCCGACCATAGATG
CTAGAGTGGAATCCAAGGAACATGCCAAAGTTGTTGAGAAAAAGGAAGATGGTGAAATAGGTCAGAAGCTGGAGGGAGGA
AGGATTAACTTGGGACCAAAGAAAGAAGATAAATTTACAAAACCAGTTGTTGGTGATGAGGCAAGAAGAATAGAGAAGAA
TGTTGCTCAGAGAAACCAAGCAGAGCCTAAGCTAAAAACGAAAGAGGGAGATGAAAGAATCAAACTGGATGTTGATGATG
GCGTGAGAAACAAGCAGGATGAGAATAATGAGATGGTTGGAGACATGGTTAGTGAAGGAGAGATTCAAGACAGAGTGGAG
CAGAAGAAGATAGACGAAGCTGGTTTAGCCAAAGATAGAGGCGATCTAAAGGATAATGCTGAAGTCGTGGAACCAGAAAC
CGGTCCATTACTAGTCAAAGAAGGACAGAAGAAGAGCGACATGGATCCTCCTCTTGCAGTAGGAGGAAGAGGAATGGGTG
AAGAAGAGAGTCGGACATATGACATACCTTTGGTGAATGTTGGTGTAGCTGCTCTTGTGATTATGGGGTTTGGTGCTTAC
GTCTTTGTACCACTAGTAAAATATTTCTCCTGA