Details for Arabidopsis Locus AT3G10670

Position : Chr3 ( 5`- 3335049 .. 3337387 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10670

Protein [Map View]
MAGVNLQLRHAYSIAQFVPTVSSPPPLPTQRVRLGTSPSRVLLCNLRANSAAAPILRTTRRSVIVSASSVSSAVDSDSLV
EDRDDVGRIPLLEVRDLRAVIAESRQEILKGVNLVVYEGEVHAVMGKNGSGKSTFSKVLVGHPDYEVTGGSIVFKGQNLL
DMEPEDRSLAGLFMSFQSPVEIPGVSNMDFLNMAFNARKRKLGQPELDPIQFYSHLVSKLEVVNMKTDFLNRNVNEGFSG
GERKRNEILQLAVLGAELAILDEIDSGLDVDALQDVAKAVNGLLTPKNSVLMITHYQRLLDYIKPTLIHIMENGRIIKTG
DNSLAKLLEKEGYKAISG*

DNA
ATGGCCGGCGTTAACCTACAGCTCCGTCACGCATACTCCATAGCTCAATTCGTTCCAACTGTTTCTTCTCCTCCTCCTCT
TCCTACTCAGCGAGTTCGCCTCGGGACTTCACCCTCTCGTGTTCTATTATGCAATCTCCGAGCTAATTCCGCCGCCGCTC
CAATCCTGCGAACTACTCGCCGTTCAGTTATTGTTTCGGCGTCTTCCGTATCCTCAGCCGTCGATTCGGATTCGTTGGTG
GAAGATCGTGATGACGTGGGGAGGATCCCGTTGCTTGAAGTTAGGGATTTGAGAGCAGTGATTGCTGAATCGAGACAAGA
GATACTGAAAGGCGTCAATTTGGTTGTCTACGAAGGAGAGGTTCACGCAGTGATGGGGAAGAACGGTTCAGGAAAGAGCA
CGTTTTCGAAGGTTCTTGTTGGTCATCCCGATTATGAAGTGACGGGAGGGAGTATTGTGTTTAAAGGGCAGAATCTACTT
GATATGGAACCAGAGGATAGATCTCTTGCCGGTCTCTTTATGAGTTTCCAGTCCCCAGTTGAGATCCCTGGTGTTAGCAA
TATGGATTTCTTGAATATGGCATTCAATGCTCGGAAAAGAAAGCTTGGTCAGCCAGAGCTTGATCCAATCCAGTTCTACA
GCCACTTGGTATCAAAACTCGAAGTTGTGAATATGAAGACCGATTTTCTCAACAGAAATGTCAATGAAGGATTTAGTGGT
GGTGAAAGGAAACGCAATGAGATTCTACAGTTAGCGGTCCTTGGAGCTGAGTTGGCTATACTGGACGAGATTGATTCAGG
GTTGGATGTTGATGCTCTTCAAGATGTGGCAAAGGCGGTGAACGGGCTTTTGACACCAAAAAACTCTGTTCTGATGATAA
CGCACTACCAACGCCTACTTGACTACATCAAACCAACTCTCATACATATCATGGAGAATGGGAGAATCATTAAAACCGGA
GACAACTCCTTGGCCAAACTACTGGAAAAGGAAGGCTACAAAGCGATATCCGGTTAG