Details for Arabidopsis Locus AT3G10630

Position : Chr3 ( 5`- 3321463 .. 3323211 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10630

Protein [Map View]
MDQPPDRSKRPWKFSTIVYSSSILFLLLSIFLLGFTNTDLYKVQSLRFTFTVNRFYSYLQFLLGFHDGTPKSKSETLNPA
SSTPHCVLWMAPFLSSGGYSSEAWSYVLSLRNHLTNPRFRITIEHHGDLESVEFWNGLAKETKEVAIEMYREQCRPNETI
VVCHSEPGAWYPPLFETLPCPPTGYEDFLSVIGRTMFETDRVNPEHVKRCNQMDHVWVPTDFHVSSFVQSGVDSSKVVKI
VQPVDVGFFDPSKYKPLDLMAVGDLVLGSGMKNGFVFLSVFKWEQRKGWDVLLKAYLSEFSGEDNVALFLLTNAYHSDSD
FGNKILDFVEEMNIEEPRNGYPFVYVIDKHIAQVDLPRLYKAADAFVLPTRGEGWGRPIVEAMAMSLPVITTNWSGPTEY
LTERNGYPLVVEEMSEVKEGPFEGHQWAEPSVDKLRVLMRRVMSNPDEAKVKGKRGRDDMVKNFAPEVVAKVVADQIARI
FDEKIRT*

DNA
ATGGATCAACCACCAGATCGAAGCAAGCGACCATGGAAATTCTCCACCATCGTCTACTCTTCATCGATCTTATTCCTTCT
ACTTTCGATATTCTTACTTGGCTTCACAAATACCGATCTCTACAAAGTCCAAAGTCTGAGATTCACCTTCACTGTGAACC
GCTTCTATAGCTATCTTCAATTCCTTCTAGGCTTTCATGATGGAACTCCCAAATCCAAATCCGAAACCCTAAATCCAGCT
TCTTCTACGCCGCACTGCGTGTTATGGATGGCTCCTTTTCTCTCGAGTGGTGGTTACAGCTCAGAAGCTTGGTCTTACGT
TTTATCACTTCGTAACCATCTCACAAACCCTAGATTTCGAATCACCATCGAGCACCATGGTGATCTAGAATCAGTGGAGT
TTTGGAATGGTTTAGCTAAGGAGACGAAGGAGGTAGCGATTGAAATGTATAGAGAACAGTGTAGACCCAATGAGACGATA
GTTGTTTGTCATAGTGAGCCTGGTGCTTGGTATCCACCATTGTTTGAGACTCTACCTTGTCCTCCAACTGGCTACGAAGA
TTTCTTATCTGTGATTGGTAGAACAATGTTTGAGACTGATAGAGTCAATCCAGAGCATGTGAAGCGATGTAATCAAATGG
ATCATGTTTGGGTTCCTACTGATTTTCACGTCTCTTCGTTTGTACAAAGTGGGGTTGATTCATCTAAGGTTGTCAAGATT
GTGCAGCCTGTAGATGTCGGTTTCTTCGATCCTTCAAAGTATAAGCCTTTGGATCTGATGGCGGTTGGGGATTTGGTTTT
AGGTTCTGGGATGAAGAATGGGTTTGTGTTCTTGAGTGTGTTTAAATGGGAGCAGAGGAAAGGTTGGGATGTATTGTTGA
AAGCTTACTTGAGTGAGTTTTCTGGTGAAGACAATGTTGCTCTGTTTTTGTTGACGAACGCGTATCACTCGGACAGCGAT
TTCGGGAACAAGATTCTTGATTTCGTAGAAGAAATGAATATAGAAGAGCCTCGGAATGGTTACCCTTTTGTGTATGTGAT
TGATAAACACATTGCTCAAGTTGATTTACCTCGGTTGTACAAAGCGGCTGATGCGTTTGTGTTGCCTACAAGAGGAGAAG
GATGGGGACGACCTATAGTGGAAGCCATGGCTATGTCTTTGCCTGTGATCACAACAAACTGGTCAGGACCAACAGAGTAT
CTTACAGAGCGGAATGGTTACCCGTTGGTGGTAGAGGAGATGAGTGAAGTGAAGGAAGGTCCTTTTGAAGGGCATCAATG
GGCAGAGCCATCTGTGGATAAGCTGAGGGTTCTAATGAGGCGTGTAATGAGTAACCCTGATGAGGCTAAGGTTAAAGGAA
AACGTGGAAGAGATGACATGGTCAAGAATTTTGCTCCTGAGGTTGTTGCTAAGGTTGTAGCGGATCAAATAGCGAGAATC
TTTGATGAGAAAATAAGAACATGA