Details for Arabidopsis Locus AT3G10620

Position : Chr3 ( 5`- 3320263 .. 3321724 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10620

Protein [Map View]
MALYRPLLLHHPTSPSVTTFLRNYPSKPIKFSSLPFLHRCRKSRVSSSSARCCSSMESPPEGYRRNVGVCLMNSSKKIFT
ASRLDIPSAWQMPQGGIDEGEDPRVAVMRELKEETGVHSAEILAEAPHWITYDFPPDVREKLKVRWGSDWKGQAQKWFLL
KFTGKDEEINLLGDGTEKPEFGEWSWTSPDQVVENAVEFKKPVYKEVMSAFASHLQ*

DNA
ATGGCACTGTACCGACCCCTTCTCTTGCATCATCCAACTTCTCCGTCTGTAACTACGTTTCTACGAAATTACCCCTCGAA
ACCGATCAAATTCTCCAGCCTGCCCTTCCTTCATCGCTGCCGTAAGTCTCGGGTCTCCTCCTCCTCCGCTCGGTGTTGTT
CTTCCATGGAATCTCCTCCTGAAGGATACAGAAGAAATGTCGGCGTCTGCCTCATGAATTCTTCCAAAAAGATTTTCACT
GCCTCGAGGTTGGATATTCCCAGTGCTTGGCAAATGCCTCAGGGTGGAATCGACGAAGGTGAAGATCCAAGAGTTGCAGT
CATGAGAGAGCTTAAAGAAGAGACTGGAGTTCACTCTGCTGAGATTCTCGCTGAGGCACCTCACTGGATAACCTATGACT
TCCCTCCTGATGTTAGGGAGAAGCTTAAGGTCCGATGGGGATCCGATTGGAAGGGTCAAGCACAGAAATGGTTTCTTCTG
AAATTTACTGGGAAAGATGAAGAAATCAATCTTCTTGGCGATGGTACTGAGAAACCTGAGTTTGGTGAATGGTCCTGGAC
TTCTCCTGATCAAGTCGTTGAAAATGCAGTGGAGTTCAAGAAGCCAGTGTACAAGGAAGTCATGTCAGCTTTCGCTTCTC
ATCTCCAGTAG