Details for Arabidopsis Locus AT3G10600

Position : Chr3 ( 5`- 3313969 .. 3317162 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10600

Protein [Map View]
MEAQYRNHDGDTSFSSLRVYLNSLSDTPSRFSRRAVSVSTSYDEMSRVRAVSGEQMRRTLRWYDLIGLGIGGMIGAGVFV
TTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAFITGANLIMDYVLSNAAVSRGF
TAYLGSAFGISTSEWRFIVSGLPNGFNEIDPIAVIVVLAVTFVICYSTRESSKVNMVLTALHIAFIVFVIVMGFSKGDVK
NLTRPDNPENPSGFFPFGVSGVFNGAAMVYLSYIGYDAVSTMAEEVKDPVKDIPMGISGSVAIVIVLYCLMAISMSMLLP
YDLIDAEAPYSAAFSKSEGWEWVTRVVGIGASFGILTSLIVAMLGQARYMCVIGRSRVVPIWFAKVHPKTSTPVNASAFL
GIFTAVLALFTDLNVLLNLVSIGTLFVFYMVANAVIFRRYVTVGYTEPWPTLSFLCLFSITSILFTLVWQLAPSGPPKWF
ILGASTVTAIAIVQIFHCVVPQARIPEFWGVPLMPWTPCVSIFLNIFLLGSLDAPSYIRFGFFSGLVVLVYVFYSVHASY
DAEGDGSLDFKDVESLERINRVLS*

DNA
ATGGAGGCCCAATACCGGAACCACGACGGAGACACCTCTTTCTCTAGCCTCCGTGTCTACCTCAACTCTCTCTCCGACAC
TCCCTCCCGTTTTTCCCGCCGAGCCGTTTCCGTTTCCACCTCTTACGACGAGATGAGCCGCGTCCGCGCCGTCTCCGGCG
AGCAGATGCGTCGTACTCTCCGTTGGTACGATCTCATCGGACTCGGAATCGGTGGAATGATCGGAGCCGGAGTCTTCGTC
ACCACCGGCCGTGCTAGTCGTCTCTACGCTGGTCCATCAATCGTCGTCTCTTACGCAATCGCCGGACTCTGTGCTCTACT
CTCCGCCTTCTGTTACACCGAGTTCGCCGTTCACCTCCCCGTCGCCGGCGGTGCTTTCAGCTACATCCGTATCACATTCG
GCGAGTTTCCGGCGTTTATAACCGGAGCAAATCTGATAATGGACTACGTACTGTCAAACGCCGCCGTTTCAAGAGGATTC
ACCGCTTATCTCGGATCTGCATTCGGAATCTCAACATCGGAGTGGAGATTCATCGTCTCCGGTCTCCCAAACGGATTCAA
CGAAATCGATCCCATCGCCGTTATCGTCGTCCTCGCCGTCACGTTCGTCATCTGTTACAGTACGAGAGAGAGTTCGAAGG
TGAATATGGTATTAACGGCGTTACACATTGCATTTATAGTATTCGTGATCGTCATGGGTTTCTCGAAAGGAGACGTAAAG
AATTTAACCCGACCCGATAACCCGGAAAACCCATCCGGATTCTTCCCGTTTGGAGTTTCGGGTGTGTTTAACGGAGCAGC
AATGGTTTATCTAAGTTACATAGGATACGACGCCGTTTCGACAATGGCTGAAGAAGTAAAAGACCCAGTCAAAGACATAC
CAATGGGAATCTCTGGCTCAGTCGCAATCGTCATTGTACTTTACTGTTTAATGGCTATCTCTATGTCAATGCTTCTCCCG
TACGATCTGATAGATGCGGAGGCACCGTATTCGGCGGCGTTTAGTAAATCGGAAGGATGGGAATGGGTGACGAGAGTGGT
TGGGATTGGAGCAAGTTTCGGGATATTAACGTCGTTGATAGTAGCCATGTTGGGTCAGGCTCGGTACATGTGCGTCATCG
GACGGTCAAGAGTTGTCCCCATTTGGTTTGCTAAGGTTCATCCCAAGACATCTACTCCAGTCAACGCTTCCGCTTTTCTT
GGAATCTTCACGGCGGTTCTCGCCCTCTTCACCGACCTAAACGTCCTCCTAAACCTAGTCTCCATCGGAACGCTCTTCGT
CTTCTATATGGTCGCAAACGCTGTTATATTTCGCCGTTACGTAACGGTCGGATACACGGAGCCATGGCCAACACTCTCCT
TCCTCTGCCTATTCTCCATAACCTCAATTTTGTTTACCTTGGTCTGGCAACTTGCACCGTCGGGCCCACCTAAATGGTTC
ATACTTGGAGCTAGCACGGTCACGGCTATAGCCATCGTCCAGATATTCCATTGTGTTGTACCTCAAGCTAGGATCCCTGA
GTTTTGGGGTGTACCGTTGATGCCGTGGACTCCATGCGTTTCGATATTTTTGAACATTTTCTTGCTTGGATCATTGGATG
CTCCTTCGTATATCAGATTCGGGTTCTTCTCGGGATTAGTGGTGCTCGTGTATGTGTTTTATAGTGTTCATGCAAGCTAT
GATGCTGAAGGAGACGGGTCTCTTGATTTCAAAGACGTGGAAAGCCTTGAAAGAATTAACAGAGTGTTGAGTTAA