Details for Arabidopsis Locus AT3G10595

Position : Chr3 ( 5`- 3311785 .. 3312831 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10595

Protein [Map View]
MAENSWTTEENEMFKDALVMFTAFLLTRFESVAEYVDRSVDDVKEHYKELVNDLLEMGSSRVAFPNELTKDMAQSSYQAE
RTIWTKETHEWFLIGLDRFGKDWRKIAVLLDCKSPIQVEIYAENFYQWQSSKKNVINDLNVASTDVNVMKRQGANNTNVD
STGQQESLVALEIGHHAKAPNSK*

DNA
ATGGCTGAAAATTCATGGACGACAGAGGAGAACGAGATGTTCAAGGATGCACTGGTGATGTTCACTGCCTTTTTGCTTAC
TCGGTTTGAGAGTGTCGCCGAGTATGTGGATAGATCGGTGGATGATGTTAAGGAGCATTACAAGGAATTGGTCAATGATC
TTTTAGAGATGGGATCCAGTCGAGTAGCTTTTCCTAATGAATTGACTAAGGATATGGCTCAAAGTTCGTACCAGGCCGAG
AGAACTATATGGACCAAAGAAACACATGAATGGTTTCTGATTGGGTTAGACCGATTTGGGAAAGATTGGCGTAAAATAGC
CGTCTTATTGGATTGCAAGAGCCCGATCCAAGTCGAGATATATGCAGAAAACTTTTACCAGTGGCAAAGCTCAAAGAAAA
ATGTGATTAACGACTTAAATGTGGCAAGCACCGATGTGAATGTGATGAAACGGCAGGGAGCAAATAACACCAATGTGGAC
TCAACAGGCCAACAAGAGAGTCTCGTCGCTCTGGAAATCGGTCACCATGCTAAGGCCCCCAACTCAAAGTGA