Details for Arabidopsis Locus AT3G10580

Position : Chr3 ( 5`- 3307051 .. 3308237 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10580

Protein [Map View]
MDAAIPIWKRDDDKRFELALVRFPAEGSPDFLENIAQFLQKPLKEVYSYYQALVDDVTLIESGKYPLPKYPEDDYVSLPE
ATKSKTQGTGKKKGIPWSPEEHRLFLDGLNKYGKGDWKSISRECVTSRSPMQVASHAQKYFLRQKNKKGKRFSIHDMTLG
DAENVTVPVSNLNSMGQQPHFDDQSPPDHYQDYFSQSNVTIPGCNMHFMGQQPRFGDQIPPGEYHPYSRDNVTVTGSNLN
SIGQQPHFNDQISPDQYGRYLQENFGFFDDDGEDDGSLASFQQLYKA*

DNA
ATGGATGCAGCAATTCCGATTTGGAAGAGGGACGATGATAAGCGTTTTGAGTTAGCTCTGGTTCGATTCCCTGCTGAGGG
TTCGCCGGATTTTTTAGAGAATATCGCTCAGTTTCTGCAGAAACCGTTAAAGGAGGTGTACTCCTACTACCAAGCCTTGG
TCGATGATGTTACGCTGATCGAATCGGGTAAGTATCCTTTGCCCAAGTACCCGGAAGATGATTACGTGTCACTGCCGGAA
GCGACTAAGTCTAAAACCCAGGGCACGGGGAAAAAGAAGGGAATACCTTGGTCACCAGAAGAACACAGATTGTTTTTGGA
TGGACTAAACAAGTATGGGAAAGGAGATTGGAAGAGCATATCGAGGGAATGTGTGACGTCAAGGAGCCCGATGCAAGTGG
CAAGCCATGCTCAGAAGTATTTCTTAAGGCAAAAAAATAAGAAGGGGAAACGCTTCAGTATCCATGATATGACTCTGGGA
GATGCCGAAAATGTAACCGTCCCTGTATCCAACTTGAATTCTATGGGCCAGCAGCCACATTTTGATGACCAAAGTCCTCC
GGATCATTATCAAGACTACTTCTCCCAGAGCAATGTAACCATCCCTGGATGCAACATGCACTTTATGGGCCAGCAACCAC
GTTTTGGTGACCAAATTCCTCCGGGTGAATATCACCCCTACTCCCGGGACAATGTAACCGTCACTGGATCCAACTTGAAT
TCTATTGGCCAGCAGCCACATTTTAATGACCAAATTTCTCCGGATCAATATGGCCGCTACTTGCAGGAAAACTTCGGGTT
TTTCGATGATGATGGTGAAGATGATGGGAGTTTAGCAAGCTTTCAACAACTATACAAGGCTTAA