Details for Arabidopsis Locus AT3G10572

Position : Chr3 ( 5`- 3304268 .. 3306504 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10572

Protein [Map View]
MEATDIWGEIERSESYLVCSMYEEAESLSSSILKRIFGNIDVLSDEASQGDHQFHDMLESAGMVLVQSLHGIGRTVEIVN
ELRDVFGEVAAIPVQVLLTGVCLQISNGSYLGVRDILEEFFRIWVYKDNHYILNDAGVSTKGFHAKNCLDIDEYMEVVEL
YTFGVLAKFSNDMGLAISWVEKAALPEERRQGILRRLHSLLSLKTASSFEENSKDSSYAVVNNKKSLGNEKNDEIDSFLK
LSKQHEPWSLWSSHPLSLKVGNTQFSMSRGKVAVSLVGLIICYALKRKRAALIRIIRRQMESTRKAIVDFWKLAFSYQVN
PLAAIQSIPSTTT*

DNA
ATGGAGGCAACTGATATTTGGGGAGAAATTGAACGTTCTGAGAGTTACCTAGTGTGCTCTATGTATGAAGAGGCAGAGTC
ATTATCTTCCTCTATACTGAAAAGAATATTTGGCAACATTGATGTTTTATCCGACGAAGCTTCTCAAGGTGATCATCAAT
TTCATGATATGTTGGAATCTGCTGGTATGGTCTTAGTTCAATCCTTGCATGGAATCGGCAGGACAGTTGAGATTGTAAAT
GAGTTAAGAGATGTGTTTGGAGAAGTTGCAGCTATTCCTGTTCAAGTTCTTCTTACTGGAGTATGCCTTCAAATATCAAA
TGGTTCCTATTTGGGTGTACGTGATATTCTGGAAGAGTTCTTTAGAATATGGGTTTACAAGGACAACCACTATATCCTAA
ATGATGCTGGAGTAAGTACAAAAGGATTCCATGCGAAAAACTGTTTAGATATTGATGAGTACATGGAAGTCGTTGAGCTG
TATACTTTTGGAGTTCTTGCAAAATTTTCAAATGACATGGGCCTAGCCATTTCATGGGTTGAAAAAGCTGCATTGCCTGA
GGAAAGGCGACAGGGGATTTTGAGAAGATTGCATTCCTTACTTTCTCTCAAAACAGCTAGTTCTTTTGAGGAAAATTCCA
AAGATTCTTCTTATGCTGTAGTGAATAACAAGAAGTCGTTGGGTAATGAAAAGAATGATGAGATTGATTCTTTCCTGAAA
CTATCTAAACAGCATGAACCTTGGTCACTTTGGTCATCCCATCCTCTAAGCCTCAAGGTTGGTAATACCCAATTTAGCAT
GTCCAGGGGAAAGGTTGCCGTAAGCCTTGTTGGATTAATCATATGTTATGCTTTGAAGAGAAAACGAGCTGCTTTGATAA
GGATCATTCGCAGGCAAATGGAGTCCACGAGAAAAGCAATAGTAGATTTCTGGAAGCTTGCGTTTTCATACCAAGTGAAT
CCTCTTGCAGCAATTCAATCCATACCAAGCACCACAACATGA