Details for Arabidopsis Locus AT3G10540

Position : Chr3 ( 5`- 3289695 .. 3292702 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10540

Protein [Map View]
MLTMDKEFDSKLTLQGNSSSNGETISRSKSFAFKAPQENFTYHDFELGKIYGVGSYSKVVRAKKKDNGTVYALKIMDKKF
ITKENKTAYVKLERIVLDQLEHPGIVKLFFTFQDTQSLYMALESCEGGELFDQITRKGRLSEDEARFYSAEVVDALEYIH
NMGLIHRDIKPENLLLTLDGHIKIADFGSVKPMQDSQITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALG
CTLYQMLSGTSPFKDASEWLIFQRIIARDIKFPNHFSEAARDLIDRLLDTDPSRRPGAGSEGYDSLKRHPFFKGVDWKNL
RSQTPPKLAPDPASQSASPERDGSPWNPTHVGDTSVLQNDGHNGLSESSGSITRLASIDSFDSRWQQFLEPGESVLMISA
VKKLQKITSKKVQLILTNKPRLIYVDPSKLVVKGNIIWSDNSNDLNVQVSSPSHFKICTPKKVLSFEDAKQRALQWKKAI
ETLQNR*

DNA
ATGTTGACAATGGACAAGGAATTTGATTCAAAGCTTACTCTTCAAGGGAATTCATCTTCAAATGGTGAAACTATTTCCAG
AAGCAAAAGCTTCGCCTTTAAGGCTCCTCAGGAGAATTTCACTTACCATGATTTCGAGCTCGGCAAGATCTATGGCGTTG
GCTCTTATTCTAAGGTTGTTAGGGCGAAGAAGAAGGATAATGGAACTGTGTATGCCTTGAAGATCATGGACAAAAAGTTT
ATCACCAAGGAGAATAAAACAGCTTATGTCAAATTGGAGAGGATTGTTCTTGATCAACTCGAACATCCCGGGATTGTGAA
ACTCTTCTTTACGTTTCAGGATACACAATCACTATACATGGCGCTTGAGTCTTGTGAAGGTGGGGAACTTTTCGACCAAA
TCACCAGAAAAGGTCGTCTATCTGAGGATGAAGCTCGGTTCTACAGTGCAGAAGTTGTTGATGCTCTTGAGTATATACAT
AATATGGGACTGATACATCGAGATATTAAGCCGGAGAATCTGTTGTTAACTTTAGATGGGCACATAAAGATTGCTGATTT
TGGTAGCGTAAAGCCAATGCAAGACAGCCAAATCACAGTGCTTCCTAATGCGGCTTCTGATGATAAGGCGTGCACTTTTG
TCGGGACGGCTGCATATGTTCCTCCTGAAGTTCTAAACTCCTCTCCAGCAACGTTCGGAAATGATCTCTGGGCACTCGGC
TGCACTCTGTACCAAATGCTTTCAGGAACTTCCCCATTCAAGGATGCAAGTGAATGGCTGATTTTCCAAAGAATTATAGC
TAGAGATATAAAGTTTCCAAATCATTTCTCAGAAGCAGCAAGAGACCTCATCGACCGATTGCTAGATACAGATCCTAGTA
GAAGACCAGGAGCTGGATCAGAAGGTTATGATTCTCTCAAGAGACATCCTTTCTTCAAGGGAGTTGACTGGAAGAACCTA
AGGTCACAAACTCCTCCAAAACTAGCTCCAGATCCTGCGTCTCAATCAGCATCTCCTGAGAGGGACGGTTCTCCATGGAA
TCCAACACATGTTGGAGATACCTCAGTCTTGCAGAACGATGGACACAATGGACTCTCTGAATCCTCAGGTTCCATAACTC
GGCTTGCCTCCATAGACTCTTTCGATTCAAGATGGCAACAGTTTCTAGAACCGGGAGAATCGGTTCTAATGATATCAGCA
GTGAAGAAGCTACAGAAAATCACAAGTAAGAAGGTGCAGCTAATACTCACCAACAAACCAAGACTGATATACGTTGACCC
ATCAAAGCTTGTAGTAAAAGGGAATATTATCTGGTCTGATAACTCCAACGACCTCAACGTTCAAGTCTCAAGTCCTTCCC
ATTTCAAGATTTGCACACCGAAGAAAGTTTTATCGTTTGAAGATGCGAAGCAAAGAGCTTTGCAGTGGAAAAAGGCAATC
GAAACTCTTCAAAACCGTTGA