Details for Arabidopsis Locus AT3G10520

Position : Chr3 ( 5`- 3276226 .. 3277860 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10520

Protein [Map View]
MGEIGFTEKQEALVKESWEILKQDIPKYSLHFFSQILEIAPAAKGLFSFLRDSDEVPHNNPKLKAHAVKVFKMTCETAIQ
LREEGKVVVADTTLQYLGSIHLKSGVIDPHFEVVKEALLRTLKEGLGEKYNEEVEGAWSQAYDHLALAIKTEMKQEES*

DNA
ATGGGAGAGATTGGGTTTACAGAGAAGCAAGAAGCTTTGGTGAAGGAATCGTGGGAGATACTGAAACAAGACATCCCCAA
ATACAGCCTTCACTTCTTCTCACAGATACTGGAGATAGCACCAGCAGCAAAAGGCTTGTTCTCTTTCCTAAGAGACTCAG
ATGAAGTCCCTCACAACAATCCTAAACTCAAAGCTCATGCTGTTAAAGTCTTCAAGATGACATGTGAAACAGCTATACAG
CTGAGGGAGGAAGGAAAGGTGGTAGTGGCTGACACAACCCTCCAATATTTAGGCTCAATTCATCTCAAAAGCGGCGTTAT
TGACCCTCACTTCGAGGTGGTGAAAGAAGCTTTGCTAAGGACATTGAAAGAGGGGTTGGGGGAGAAATACAATGAAGAAG
TGGAAGGTGCTTGGTCTCAAGCTTATGATCACTTGGCTTTAGCCATCAAGACCGAGATGAAACAAGAAGAGTCATAA