Details for Arabidopsis Locus AT3G10480

Position : Chr3 ( 5`- 3264348 .. 3267090 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10480

Protein [Map View]
MGRESLAVVSSPPSATAPSTAVSATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGEVDIYKHEPWDLAEKILCSY
LALNCFKNFVFACATVMFACATVMFALFSKLKTRDQEWYFFSALDKKYGNGARMNRATNKGYWKATGKDREIRRDIQLLG
MKKTLVFHSGRAPDGLRTNWVMHEYRLVEYETETNGSLLQDAYVLCRVFHKNNIGPPSGNRYAPFMEEEWADGGGALIPG
IDVRVRVEALPQANGNNQMDQWADLLKLHNSIKFAITFCRTQLNLTALSNERCSTREIFIVFWLICKEMHSASKDLININ
ELPRDATPMDIEPNQQNHHESAFKPQESNNHSGYEEDEDTLKREHAEEDERPPSLCILNKEAPLPLLQYKRRRQNESNNN
SSRNTQDHCSSTITTVDNTTTLISSSAAAATNTAISALLEFSLMGISDKKENQQKEETSPPSPIASPEEKVNDLQKEVHQ
MSVERETFKLEMMSAEAMISILQSRIDALRQENEELKKKNASGQAS*

DNA
ATGGGTCGCGAATCTCTGGCTGTTGTGTCCTCGCCGCCATCGGCGACTGCGCCCAGTACTGCTGTGTCGGCTACCTCGCT
TGCTCCTGGCTTTCGATTTCATCCGACTGATGAGGAACTCGTGAGCTATTACTTGAAGAGGAAGGTTCTGGGTAAACCTG
TACGCTTCGATGCGATTGGAGAGGTAGATATCTACAAGCATGAGCCCTGGGATTTAGCAGAGAAGATTCTCTGTTCGTAC
CTGGCGCTAAATTGCTTTAAGAATTTCGTGTTTGCTTGTGCTACAGTTATGTTTGCTTGTGCTACAGTTATGTTTGCTTT
GTTTTCGAAGTTGAAAACTCGGGACCAAGAATGGTACTTCTTCAGTGCGTTAGATAAGAAGTACGGTAATGGTGCTAGGA
TGAATCGAGCAACTAACAAAGGGTACTGGAAAGCAACTGGAAAAGACAGAGAAATCCGCCGGGATATTCAGTTGCTCGGT
ATGAAAAAGACGCTTGTTTTCCACAGCGGGCGTGCTCCAGACGGCCTTCGGACTAATTGGGTCATGCACGAGTATCGCCT
TGTGGAATATGAAACTGAAACTAACGGAAGCCTGCTGCAGGATGCATATGTGTTGTGCAGAGTGTTTCACAAGAATAACA
TTGGGCCACCAAGTGGGAACAGATATGCGCCATTCATGGAAGAAGAATGGGCTGATGGTGGAGGAGCTCTGATTCCAGGA
ATAGACGTTAGGGTCAGGGTAGAGGCTCTACCACAAGCCAATGGAAACAACCAGATGGACCAGTGGGCTGATTTACTTAA
ACTGCACAATTCCATTAAGTTTGCTATCACCTTTTGTAGAACTCAGCTCAACCTTACAGCTTTATCTAATGAAAGGTGCT
CAACAAGAGAAATATTTATTGTGTTTTGGTTAATCTGCAAAGAAATGCATTCAGCAAGCAAGGATCTCATTAACATCAAC
GAGCTACCGAGAGATGCTACTCCAATGGACATCGAACCTAACCAACAGAATCATCATGAGAGTGCCTTCAAGCCACAGGA
GAGTAACAACCATAGTGGTTATGAAGAAGATGAGGACACACTCAAACGCGAGCACGCAGAAGAAGATGAGCGTCCTCCTT
CTCTATGCATTCTCAACAAAGAAGCTCCACTACCTCTCCTGCAATACAAACGTAGACGCCAAAACGAGTCCAACAACAAC
TCAAGCAGGAACACACAGGACCATTGTTCGTCCACAATAACAACCGTCGACAATACAACCACCTTAATCTCATCATCTGC
TGCTGCTGCTACCAACACTGCCATCTCTGCATTGCTTGAGTTCTCACTTATGGGTATCTCCGACAAGAAAGAAAACCAGC
AGAAAGAGGAAACTTCTCCTCCTAGTCCAATTGCATCTCCTGAAGAGAAGGTTAATGATCTCCAGAAGGAGGTTCACCAG
ATGTCTGTTGAAAGAGAAACTTTCAAGCTTGAGATGATGAGTGCAGAGGCTATGATCAGCATTCTCCAGTCAAGAATCGA
TGCGCTGCGTCAGGAGAACGAGGAACTTAAGAAGAAGAACGCCAGTGGACAAGCTAGTTAA