Details for Arabidopsis Locus AT3G10470

Position : Chr3 ( 5`- 3260351 .. 3261854 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10470

Protein [Map View]
MEAAAEAVSAAREQSLILKGKRTKRQRPQSPIPFSIIPPMSSHEPDAEEESTSLVSKEKSLNDEINNNNIKNNNNTLING
VTSSSSASSSSNNNATLKATADEEDQDMANCLILLAQGHSLPHLQPQPHPQQQTRQLMMSYQDSGNNNNNAYRSSSRRFL
ETSSSNGTTTNGGGGRAGYYVYQCKTCDRTFPSFQALGGHRASHKKPKAAMGLHSNHDHKKSNYDDAVSLHLNNVLTTTP
NNNSNHRSLVVYGKGSNNKVHECGICGAEFTSGQALGGHMRRHRGAVVAAAAASTATVSVAAIPATANTALSLSPMSFDQ
MSEGPIQAPVKRARSAVVSLDLDLNLPAPEDENRVNGLSFASKQEHEQEHEQTQQKKQREEQKSLVLSSAPTLVDCHY*

DNA
ATGGAAGCAGCTGCGGAGGCTGTATCAGCCGCTAGGGAGCAATCATTGATCCTTAAAGGGAAACGGACTAAGCGGCAACG
TCCTCAGTCCCCAATCCCTTTCTCTATCATTCCTCCTATGTCTTCGCATGAACCGGATGCTGAAGAAGAGTCTACTAGTC
TTGTTTCCAAGGAGAAGAGTCTCAATGATGAAATCAACAACAATAACATCAAGAATAATAACAATACTTTGATCAATGGT
GTTACATCTTCATCTTCTGCCTCTTCATCTTCCAACAACAATGCCACATTAAAGGCCACGGCTGACGAAGAAGATCAAGA
TATGGCTAATTGTTTGATCCTCCTCGCCCAAGGTCACTCTCTTCCCCACCTCCAACCGCAACCGCACCCCCAACAACAAA
CAAGACAGCTTATGATGAGTTACCAAGATTCCGGTAACAACAACAACAATGCGTATAGATCTAGCAGCAGGAGGTTTCTA
GAGACATCTTCATCTAACGGGACCACAACGAACGGTGGTGGAGGCAGAGCCGGTTACTATGTTTACCAGTGCAAAACATG
TGACCGGACTTTTCCGTCTTTCCAAGCTCTTGGTGGGCATAGAGCCAGCCACAAGAAGCCTAAAGCCGCTATGGGTCTTC
ACTCTAACCATGACCACAAGAAGTCTAACTACGATGACGCCGTTTCTCTCCATCTCAACAACGTTCTCACCACAACTCCT
AACAACAATAGTAACCATAGATCGCTTGTGGTATACGGCAAAGGTAGTAATAATAAGGTCCATGAATGTGGGATATGTGG
AGCCGAATTCACATCCGGGCAAGCATTAGGTGGTCACATGAGACGCCATAGAGGTGCAGTGGTAGCCGCAGCAGCCGCCT
CTACCGCCACCGTATCGGTTGCGGCCATTCCGGCTACTGCAAACACGGCTTTGTCATTGTCGCCAATGTCGTTTGATCAG
ATGTCGGAGGGTCCAATTCAGGCTCCCGTTAAGAGAGCGAGGAGCGCGGTTGTGTCGTTAGATTTAGATCTGAATCTACC
TGCCCCGGAAGATGAGAATCGGGTCAACGGATTAAGCTTTGCTTCAAAGCAAGAACACGAACAAGAACATGAACAAACAC
AACAGAAGAAACAGAGAGAAGAACAAAAGTCTCTTGTCTTGTCTTCTGCTCCTACATTGGTGGATTGCCATTACTAA