Details for Arabidopsis Locus AT3G10440

Position : Chr3 ( 5`- 3245329 .. 3248987 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10440

Protein [Map View]
MVRATVLNVGDHASEGVRTNKAKGEKMVLEPPMNSAQRRKLGDITNLQNQKNLMNQGAKHQQQAILISSKENAENLQKEN
TKLMKVVMERDGIKSDLKKLRIEFQKVQEQNLLLAQANTRILAEFNTSKDQLKVLQHELGCKNGLVMARKMLLKEQTLPC
TRHASKVKAQANACGGACKTFQPNDADHEHASGSSNANSLQRNEKANSKRRVSGRKNPANSEVLDIIGRSGETCQMEDNI
DNKKLVSDSDNDAENHINDNVQSKRYCAGRQSSSSKTREASQTETLQKVVDAKEIKGDARFSLTKHSDWLKSQEPEPSES
LYESRFPLRRRSARLKSQEPEPSESFHDSIETTKRRRSAIRSAMFNIQELGVIQNLNGLPDDQEIAAKARCSAREQSTGS
KPEAVEPHDTKEIIGKSRISLRRQSARFNFQELGVTENLNGPHDDQTIAANARCCASEQSIGSKPEAVEPHDIEERIGKI
RVSSRRQSANIETPRAIKEPANPPLHDDNVEESSQISCSVSMELKRESKKKPTGDESEEMRKTTVGRPSRQAAEKIKSYK
EPSLKEKMRGGF*

DNA
ATGGTTCGAGCGACGGTTCTGAATGTCGGTGATCACGCCAGTGAAGGTGTGCGTACTAACAAAGCTAAAGGAGAGAAAAT
GGTTCTGGAACCTCCGATGAACAGTGCACAAAGACGAAAGTTGGGGGATATTACTAATTTGCAGAATCAGAAGAATCTAA
TGAATCAGGGAGCGAAGCATCAGCAACAAGCTATATTAATCTCTTCTAAAGAAAACGCTGAAAATCTTCAAAAGGAAAAC
ACAAAGCTGATGAAAGTCGTCATGGAGAGAGATGGAATCAAAAGTGATCTGAAGAAACTTAGGATTGAATTTCAGAAGGT
TCAAGAACAGAATTTGCTACTTGCCCAGGCTAACACTCGTATCTTGGCGGAGTTCAATACAAGCAAAGACCAACTGAAGG
TACTTCAGCACGAACTTGGTTGCAAGAATGGGTTAGTCATGGCCAGGAAAATGCTGCTTAAGGAGCAAACCCTTCCATGT
ACGCGTCATGCATCAAAAGTCAAGGCTCAAGCAAATGCTTGTGGTGGGGCTTGCAAAACCTTTCAGCCAAATGATGCAGA
TCATGAGCATGCTTCCGGGAGCTCCAACGCTAACTCATTGCAAAGAAATGAGAAAGCCAACAGTAAAAGGAGAGTTTCTG
GAAGGAAGAATCCCGCCAATTCCGAGGTATTAGATATAATTGGCAGATCGGGAGAGACATGTCAGATGGAAGACAACATT
GACAACAAGAAGTTGGTCTCTGATAGTGACAATGATGCTGAAAACCATATAAATGACAATGTCCAAAGCAAAAGATATTG
TGCAGGAAGACAGAGTAGCAGTTCTAAGACTCGAGAAGCCAGCCAAACAGAAACCTTGCAAAAGGTGGTTGACGCCAAAG
AAATTAAGGGGGATGCAAGGTTTTCTTTGACAAAGCATTCTGACTGGTTAAAATCTCAAGAACCTGAGCCATCTGAAAGC
CTATACGAGTCAAGGTTCCCTTTGAGAAGGCGTTCTGCCCGGTTAAAATCTCAAGAACCTGAGCCATCTGAAAGCTTCCA
TGACTCAATAGAGACAACCAAGAGGAGGAGGTCGGCAATAAGGTCTGCTATGTTTAATATCCAAGAGCTGGGCGTTATTC
AAAACTTGAACGGTTTACCTGATGATCAAGAGATTGCTGCAAAGGCCAGATGCTCTGCACGTGAACAGTCTACCGGGTCT
AAACCCGAAGCAGTAGAACCACATGACACAAAAGAGATAATCGGGAAAAGCAGGATATCTTTGAGAAGACAGTCTGCGAG
GTTTAATTTCCAAGAGCTGGGCGTGACTGAAAACTTGAATGGTCCACATGATGATCAAACGATTGCTGCAAATGCCAGAT
GCTGTGCAAGTGAACAGTCTATCGGGTCTAAACCCGAAGCAGTAGAACCACATGACATTGAAGAGAGAATCGGGAAAATC
AGAGTCTCTTCAAGAAGACAATCTGCAAACATTGAAACTCCGAGAGCCATCAAAGAACCTGCAAATCCGCCTTTGCATGA
TGACAATGTTGAGGAGTCTAGTCAGATATCATGTTCAGTTTCAATGGAGCTTAAAAGAGAATCAAAGAAGAAACCAACAG
GCGACGAATCAGAGGAAATGAGAAAAACAACTGTTGGAAGACCTTCAAGGCAAGCTGCTGAAAAAATCAAATCGTACAAG
GAACCTTCACTTAAGGAGAAGATGCGAGGGGGCTTCTGA