Details for Arabidopsis Locus AT3G10430

Position : Chr3 ( 5`- 3242750 .. 3243862 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10430

Protein [Map View]
MGSSLPFDLILEILQRTPAESLLRFKSTCKKWYELISNDKRFMYKHLDKSTKRFLRIENRERVQILDPVTEILAVSTIPN
ELRHKYFTLIHCDGLMLGMCYEELGSDPNLAVWNPVMRKIKWIKPSPPLVCYWGSDYLGFGYDKTFRDNYKILRFTYLGD
DDDDESYPKCQIYEFNSGSWRSIEAKFDGEIDVEVDGVSVNGSMYWIELQEKKNFILSFDFSKETFNRICDSPLYWDIKR
LGCFNGDRLSLLQQNEATREIHVSVTNKLSDEVVSFSRYFSVTLPDIPLFRSIDILPLPGCFIGKNRNIIAWCEQLVGKY
DDHTSIILYEIGEGGVTKRIRTGRHEADEDYNDLDNCSYVYVPSLIPVPE*

DNA
ATGGGTTCTTCTTTGCCATTTGATTTAATCTTAGAGATACTTCAGAGAACTCCGGCAGAATCTTTGCTCCGATTCAAGTC
TACGTGCAAGAAATGGTACGAACTCATCAGCAACGACAAGAGATTCATGTACAAGCACTTGGATAAATCTACGAAACGGT
TCTTAAGAATCGAGAATCGTGAGAGGGTTCAAATCTTGGATCCCGTGACCGAAATCCTCGCCGTTTCAACAATCCCAAAC
GAGCTTCGCCACAAGTATTTTACTCTGATTCACTGTGATGGTCTAATGTTGGGCATGTGTTACGAAGAACTAGGTAGTGA
CCCCAATCTTGCAGTTTGGAATCCGGTTATGAGAAAAATCAAATGGATCAAACCGTCACCACCGTTGGTTTGTTACTGGG
GAAGTGATTACTTGGGGTTTGGATACGACAAAACATTTCGTGATAACTACAAAATCTTGAGGTTTACTTATCTTGGTGAT
GATGATGATGATGAATCATATCCAAAGTGTCAGATCTATGAATTCAATTCTGGCTCGTGGAGAAGTATTGAGGCTAAGTT
TGATGGGGAAATAGATGTTGAGGTCGACGGCGTGTCTGTGAATGGAAGTATGTATTGGATTGAATTGCAGGAGAAGAAAA
ACTTCATTTTAAGTTTCGATTTCTCCAAGGAAACATTCAACCGCATATGCGATTCTCCACTCTATTGGGATATCAAACGA
TTAGGATGTTTCAATGGAGATAGACTTTCTCTGTTACAACAAAATGAAGCAACAAGGGAGATTCATGTGTCGGTGACAAA
CAAGTTGAGTGATGAGGTTGTTTCGTTCAGCAGATATTTCAGTGTGACTCTCCCTGATATTCCGTTGTTCCGGTCCATTG
ATATTCTGCCTCTTCCGGGGTGCTTTATTGGCAAGAACAGAAATATCATAGCATGGTGCGAGCAACTTGTAGGAAAATAT
GATGATCATACTAGCATCATTCTTTACGAAATTGGCGAAGGTGGGGTTACAAAACGAATTCGGACAGGACGACATGAAGC
GGATGAGGACTACAATGACCTGGATAATTGTAGCTATGTCTATGTTCCAAGTCTGATTCCCGTTCCAGAATAA