Details for Arabidopsis Locus AT3G10400

Position : Chr3 ( 5`- 3232608 .. 3233685 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10400

Protein [Map View]
MKKRKIHHSDDEEDDTFYYRYSSVAAPPPSNPKHQPSSSAKSSAPGGGSGGLAPSKSTLYVSNLDFSLTNSDIHTLFSTF
GKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTVSIAADNGRASEFIKKRVYKDKSRCYECGDE
GHLSYECPKNQLGPRERPPPPKKRGRRKEEEGEAEEISWSAAAPSLAVAEEEFEEENWASVVDNEAGERLRKREAEEEEE
RRMKRKEKKVSYFSDESDDED*

DNA
ATGAAGAAGAGGAAGATTCATCATAGCGACGACGAAGAGGACGACACTTTCTACTATCGCTATTCCTCCGTCGCGGCACC
ACCACCTTCGAACCCTAAACACCAACCTTCTTCCTCCGCCAAATCATCAGCTCCCGGCGGCGGATCTGGCGGCTTAGCTC
CTTCAAAATCAACACTCTACGTCTCCAATCTCGATTTCTCCCTCACCAATTCCGACATCCACACTCTATTCTCCACTTTC
GGCAAGGTCGCGAGAGTCACTGTTCTCAAAGATCGCCACACTCGCCAATCTCGTGGCGTCGCGTTCGTGCTCTACGTCTC
TCGTGAAGACGCGGCTAAAGCGGCGCGTTCTATGGACGCCAAGATTCTTAATGGTCGGAAACTGACGGTTTCGATCGCCG
CTGATAATGGACGTGCGTCGGAGTTTATTAAGAAGAGAGTTTACAAGGATAAATCGAGGTGTTACGAGTGTGGAGACGAA
GGGCATCTTTCGTACGAGTGCCCTAAAAATCAGTTAGGTCCAAGGGAGAGACCACCGCCGCCGAAGAAAAGGGGGCGGCG
GAAGGAGGAGGAAGGTGAGGCTGAGGAAATTAGTTGGTCTGCGGCGGCGCCTTCGTTGGCTGTGGCGGAGGAGGAATTTG
AGGAGGAGAATTGGGCTTCGGTGGTGGATAATGAAGCTGGAGAGAGGTTGAGAAAAAGAGAAGCAGAGGAAGAAGAAGAG
AGGAGGATGAAGAGAAAGGAGAAGAAAGTTAGCTACTTTAGTGATGAGAGTGATGATGAAGATTAG