Details for Arabidopsis Locus AT3G10390

Position : Chr3 ( 5`- 3229293 .. 3232345 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10390

Protein [Map View]
MVSFSAPKKRRRGRSQRSMSSLNSLPVPNVGLLPGNSNFVSSSASSSGRFNVEVVNGSNQTVKSYPGIGDEIITINKEAT
TEALLALTAGFPADSLTEEEIEFGVVPIVGGIEQVNYILIRNHIISKWRENISSWVTKEMFLNSIPKHCSSLLDSAYNYL
VTHGYINFGIAQAIKDKFPAQSSKSSVIIVGAGLSGLAAARQLMRFGFKVTVLEGRKRPGGRVYTKKMEANRVGAAADLG
GSVLTGTLGNPLGIIARQLGSSLYKVRDKCPLYRVDGKPVDPDVDIKVEVAFNQLLDKASKLRQLMGDVSMDVSLGAALE
TFRQVSGNDVATEEMGLFNWHLANLEYANAGLVSKLSLAFWDQDDPYDMGGDHCFLPGGNGRLVQALAENVPILYEKTVQ
TIRYGSNGVKVTAGNQVYEGDMVLCTVPLGVLKNGSIKFVPELPQRKLDCIKRLGFGLLNKVAMLFPYVFWSTDLDTFGH
LTEDPNYRGEFFLFYSYAPVAGGALLIALVAGEAAHKFETMPPTDAVTRVLHILRGIYEPQGINVPDPLQTVCTRWGGDP
FSLGSYSNVAVGASGDDYDILAESVGDGRLFFAGEATTRRYPATMHGAFVTGLREAANMAQSAKARGIRKRIDRNPSRNA
HSCAILLADLFRDPDLEFGSFCIIFSRRNPDPKSPAILRVTLSEPRKRNEDPKADQHSNKILFQQLQSHFNQQQQIQVYT
LLTRQQALDLREVRGGDEKRLYYLCETLGVKLVGRKGLGVGADSVIASIKAERTGRKLPSSSTSGTKSGILKAKSGALKR
KMIRRIKGPLPLKQSNNNGVSESIKSESLGNGKSLEQQQQPRIVESIGGGSSMQGESKSLSTGVASSSGGSLHVGGETMK
KIEQ*

DNA
ATGGTCTCATTCTCCGCACCAAAGAAACGAAGGAGAGGACGTTCTCAGCGCTCAATGTCTTCGCTTAATTCCCTTCCCGT
CCCTAACGTAGGTCTTCTTCCTGGTAACAGTAATTTCGTGTCATCTTCAGCTTCTTCTTCCGGTAGATTTAACGTAGAGG
TCGTCAATGGATCAAACCAGACTGTGAAAAGTTATCCTGGGATTGGTGATGAGATCATTACGATTAACAAGGAAGCTACC
ACTGAAGCTTTGCTTGCTCTCACTGCTGGGTTTCCTGCTGATTCGCTTACCGAGGAAGAGATTGAATTCGGTGTGGTGCC
TATTGTTGGAGGCATTGAACAAGTCAATTACATTTTGATTAGGAACCACATTATATCCAAATGGCGAGAAAATATATCTA
GTTGGGTCACAAAGGAGATGTTTCTTAATTCGATTCCTAAACATTGTAGTAGTCTCTTAGATTCGGCTTATAATTACTTG
GTTACACATGGATATATCAATTTTGGAATAGCACAGGCGATTAAAGATAAGTTTCCTGCTCAGTCAAGCAAGTCTAGTGT
GATTATAGTTGGTGCTGGTTTATCTGGGTTGGCTGCAGCTAGGCAACTGATGAGGTTTGGCTTCAAAGTCACGGTTTTGG
AGGGTAGGAAACGACCCGGTGGACGGGTTTATACCAAAAAGATGGAAGCTAATAGGGTAGGTGCTGCAGCGGATTTAGGT
GGGAGTGTTTTGACTGGAACATTAGGAAATCCTTTAGGGATTATAGCGAGACAGCTTGGTTCTTCTCTCTATAAGGTACG
AGACAAGTGTCCTCTTTATAGGGTGGATGGTAAGCCGGTTGATCCAGATGTGGATATAAAGGTTGAGGTAGCGTTTAACC
AGCTTCTAGACAAGGCAAGTAAACTTAGGCAGTTGATGGGTGATGTTTCCATGGATGTCTCCCTTGGGGCAGCACTCGAG
ACATTCAGGCAGGTTTCTGGGAATGATGTGGCCACCGAGGAGATGGGTTTGTTTAACTGGCATCTTGCTAACTTGGAGTA
TGCAAATGCGGGCCTAGTATCAAAGCTTTCTCTTGCATTCTGGGATCAAGATGACCCATATGATATGGGTGGAGATCACT
GCTTTCTGCCTGGAGGAAATGGAAGGCTGGTTCAGGCTTTGGCTGAAAATGTACCAATATTATATGAGAAGACCGTCCAA
ACAATCAGATATGGTTCAAATGGTGTCAAGGTAACTGCTGGAAATCAAGTGTATGAGGGTGATATGGTGCTGTGTACAGT
TCCCCTTGGTGTCCTTAAGAACGGATCCATCAAATTTGTTCCCGAATTACCTCAGAGAAAGCTTGATTGTATAAAGAGAT
TAGGTTTTGGGTTACTGAATAAAGTTGCAATGCTCTTTCCGTATGTATTTTGGAGCACAGATCTCGATACCTTTGGGCAT
CTTACTGAGGATCCGAACTATCGAGGTGAATTCTTTCTGTTCTATAGCTACGCACCGGTTGCTGGTGGTGCTCTCTTGAT
CGCGTTGGTTGCGGGAGAAGCTGCTCATAAGTTTGAGACAATGCCACCCACTGACGCAGTGACTCGTGTTCTTCATATTC
TTAGGGGTATTTATGAACCTCAAGGAATAAATGTCCCTGATCCACTTCAAACGGTCTGCACCAGATGGGGTGGGGATCCA
TTCAGTTTAGGATCTTACTCTAATGTTGCAGTGGGAGCTTCAGGCGATGATTACGATATATTAGCAGAAAGTGTGGGAGA
TGGAAGGCTTTTCTTTGCCGGAGAAGCCACAACAAGGCGATACCCTGCAACCATGCATGGAGCTTTTGTTACTGGTCTGC
GAGAAGCTGCAAACATGGCTCAATCTGCAAAGGCCCGAGGCATAAGGAAAAGAATCGATAGGAACCCATCAAGGAATGCT
CATTCCTGTGCCATTCTTCTTGCAGATTTATTTAGGGACCCTGATCTGGAATTTGGGAGTTTTTGCATAATCTTTAGTAG
GAGGAATCCAGACCCAAAATCTCCTGCTATTTTGAGGGTAACTCTAAGCGAGCCTCGTAAGAGAAACGAGGACCCAAAAG
CAGATCAGCACTCAAACAAGATACTGTTTCAGCAGCTTCAGTCTCATTTCAACCAGCAGCAACAGATTCAGGTGTATACA
TTATTAACTAGACAACAGGCTCTTGACCTGAGAGAAGTCAGAGGTGGTGATGAAAAGAGACTATACTATCTCTGTGAGAC
ACTTGGAGTGAAACTGGTGGGGAGAAAAGGTCTTGGTGTTGGAGCTGATTCAGTCATTGCTTCTATTAAAGCCGAGCGAA
CTGGTCGCAAGCTACCATCATCATCTACCTCAGGCACAAAATCTGGTATATTAAAAGCAAAATCCGGTGCATTGAAGCGG
AAGATGATCAGAAGGATTAAAGGACCGTTGCCGCTGAAGCAAAGTAATAACAATGGCGTCTCAGAGAGTATAAAATCAGA
GTCTTTAGGTAATGGCAAATCCTTAGAGCAACAACAACAACCTAGAATAGTAGAGTCGATAGGAGGAGGTAGCAGCATGC
AAGGGGAAAGCAAGTCTTTGAGCACAGGAGTTGCATCTAGTTCTGGTGGTTCCTTACATGTTGGTGGTGAGACGATGAAA
AAGATTGAACAATGA