Details for Arabidopsis Locus AT3G10380

Position : Chr3 ( 5`- 3219523 .. 3228933 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10380

Protein [Map View]
MGIFNGLPVPSDKTYLREELARIDESWAAARFDSLPHVVHILTSKDREADIHILKEQSDVVEEVVDEVVHAYHGGFNKAI
QNYSQILRLFSESTEKIGDLKHDLAEAKQSLGARNKQLHQLWYRSVTLRHIISLLDQIEGIAKVPSRIEKLIADKQFYAA
IQVYLQSSLMLEREGLQTVGALQDVRSELTKLRGALFFKILDDLHAHLYNRGEYSSVASSIYERDDEVPTTTAVAASRMS
SQPLSRRTRTLKGDSQFGVRGLTNGSYRTASNDESSSFDGHDEEDSVEHDESTADTARNGTDSKLLSHQLPPWLSDSTPD
EFIEAVRKSDDPLHVKYLQTLVQCLCMLGKVAAAGAIICQKLRPTIHEIIISKIKAHLETTNLSKSACSQGDRSVAAGLH
LIKGQSEAYRLSKEKPQNGISNSGTHLAVSPVSPLMAPGGKAQAAAKELLDSILDTIVKIFENHVVIGELLEMKASQHDI
NTPRSLPTDVNWNTESEASQATGGYTISFPLTVLQSECQQLICEILRATPEAASADAAAQTAKLAKKAPKKDKRDAPEDG
LTFTFRFTDATVSISNQGADLIRQGWGKRAPNASLEGYGSAAVLPEQGIYLAASIYRPVLQFTDKITSMLPKKHSQLVND
GLLTFTENFVKDHLLPTMFVDYRKGVQQAISSAAAFRPRAHTTTYTATVEKGRPILQGLLAIDLLAKEVLGWAQAMPKFA
TDLVKYVQTFLERTFERCRTSYMEAVLEKLSYMLIGRHDIEKLMRLDAASACLPSTLGHAVSHSEAVGTEVELSDLFLSL
RPIKQDNLIRDDNKLILLASLSDSLEYVADSIERLGQAVPRVASQAEGNSRNQAASPRNLASFADEYRKLATDCLKVLRV
EMQLETVFHLQEMTNREYLEDEDAEEPDDFVISLTSQITRREEGMAPFISGEKRNYVFGGISGIAANASIKALADMRSIN
LFGVQQICRNTIAVEQAMAAIPYIDGETVQQNLDRVRTYFELLNMPFEALLAFIAEHDQMFTPTEYSNLLKVNVPGRDTP
SDAQSRLLEILSH*

DNA
ATGGGGATTTTCAATGGTTTGCCTGTACCCTCGGATAAAACTTACCTTAGGGAGGAGCTGGCAAGAATAGATGAGAGCTG
GGCTGCTGCACGATTTGACTCTTTACCACATGTTGTTCATATTTTGACATCAAAAGACCGTGAAGCTGACATTCATATAT
TAAAGGAACAAAGTGATGTTGTCGAGGAGGTTGTTGATGAAGTTGTCCATGCTTATCATGGTGGTTTCAACAAGGCCATT
CAAAACTATTCACAGATCTTGCGATTATTCAGTGAGTCCACTGAAAAGATAGGCGACTTGAAGCACGATTTAGCAGAAGC
GAAACAGAGCTTGGGTGCACGCAATAAACAATTACATCAGTTGTGGTACCGTTCTGTTACATTGCGGCACATCATCTCAC
TTTTGGATCAAATCGAGGGCATTGCCAAGGTTCCATCTCGTATTGAGAAGCTCATTGCTGATAAGCAGTTTTACGCTGCT
ATTCAAGTGTATCTCCAGTCGTCTCTAATGCTGGAGCGTGAGGGGCTTCAAACGGTTGGTGCTCTTCAAGATGTCAGATC
TGAGCTAACTAAGTTGCGGGGAGCCCTTTTCTTCAAAATTCTAGATGATTTGCATGCACACCTATACAATAGAGGTGAAT
ACAGTTCAGTTGCGTCAAGCATATATGAAAGAGATGATGAAGTACCAACGACAACAGCTGTTGCAGCTAGTCGAATGAGC
TCACAACCACTGTCACGTAGAACACGGACACTGAAAGGTGATAGTCAGTTTGGTGTTAGAGGGCTCACAAATGGTTCATA
TAGAACCGCTTCTAATGATGAAAGTTCATCATTTGATGGACATGATGAAGAAGACTCCGTAGAACATGATGAATCCACCG
CAGATACTGCCAGGAATGGCACTGATAGTAAATTGCTTTCTCACCAACTTCCTCCATGGCTTTCTGATTCCACTCCTGAT
GAGTTTATTGAAGCAGTAAGAAAGAGTGATGATCCACTGCATGTGAAGTATCTACAGACCCTTGTTCAGTGTCTCTGCAT
GCTTGGCAAAGTTGCAGCTGCTGGTGCTATCATATGCCAAAAACTTCGACCCACAATTCATGAAATCATAATATCCAAGA
TTAAAGCCCATCTGGAGACTACAAATTTGTCAAAGTCCGCGTGTAGTCAGGGTGATCGAAGTGTAGCTGCTGGATTGCAT
TTAATCAAAGGACAGTCAGAGGCCTACCGGTTATCAAAAGAGAAACCTCAAAATGGGATATCAAATTCAGGAACTCACCT
AGCTGTGAGCCCTGTTTCGCCTCTTATGGCTCCTGGAGGCAAAGCGCAGGCTGCAGCGAAGGAACTTCTTGACTCAATTT
TAGATACTATTGTCAAGATATTTGAAAATCATGTTGTTATTGGAGAGCTTTTGGAGATGAAGGCTTCACAACATGACATT
AACACACCAAGGTCATTGCCTACTGATGTGAATTGGAACACCGAGTCTGAAGCATCCCAAGCTACTGGAGGCTACACTAT
CAGTTTTCCCTTGACAGTCTTACAGAGTGAATGCCAACAACTCATATGTGAGATTCTACGAGCAACTCCAGAAGCTGCTT
CAGCAGATGCTGCTGCACAAACTGCTAAGCTTGCAAAGAAGGCTCCGAAGAAAGACAAAAGGGATGCACCTGAGGATGGC
CTAACATTCACCTTTCGGTTTACAGATGCAACTGTATCAATATCTAATCAGGGAGCCGATCTCATTCGTCAAGGCTGGGG
AAAGAGGGCTCCAAATGCATCACTGGAAGGTTATGGATCTGCAGCTGTTTTGCCTGAACAAGGAATATATCTAGCTGCAT
CTATTTACCGGCCTGTTCTTCAGTTTACAGATAAAATCACTTCAATGTTGCCCAAAAAGCATTCCCAGCTTGTGAATGAT
GGATTGCTTACATTCACTGAAAACTTTGTGAAGGACCATCTGTTACCGACAATGTTTGTGGACTATAGGAAAGGCGTACA
GCAAGCTATATCAAGCGCTGCTGCATTTCGGCCGCGTGCACATACAACTACTTACACCGCAACCGTAGAAAAGGGACGAC
CTATCTTACAAGGTCTTCTAGCAATAGATCTCCTTGCAAAAGAGGTTCTTGGCTGGGCTCAAGCCATGCCTAAATTTGCT
ACTGATCTTGTGAAGTATGTTCAGACATTTCTTGAGAGGACATTTGAGAGATGTCGAACATCATACATGGAGGCTGTTCT
AGAGAAGCTCAGTTACATGCTCATTGGGAGGCATGATATTGAGAAATTGATGCGGCTTGATGCGGCGAGTGCTTGTTTAC
CATCTACGCTTGGCCATGCCGTTTCTCACTCTGAGGCTGTTGGCACTGAAGTAGAACTCAGTGACCTATTCTTGAGTTTG
CGACCTATCAAGCAGGATAATCTAATTCGTGATGACAACAAACTGATTTTGTTAGCTTCTCTCAGTGACTCGCTTGAATA
CGTGGCAGACTCTATTGAGAGGCTTGGACAAGCAGTTCCTCGTGTGGCGAGTCAAGCTGAAGGTAATAGCAGAAATCAAG
CAGCTTCTCCTAGGAATCTGGCATCATTTGCAGATGAGTACAGAAAACTTGCGACTGATTGCCTAAAGGTTCTTCGTGTT
GAGATGCAATTGGAAACAGTCTTTCATCTTCAGGAAATGACGAATAGGGAATATTTGGAGGATGAGGATGCTGAAGAGCC
GGACGACTTTGTGATATCTCTTACTTCACAGATAACACGTAGGGAGGAGGGAATGGCGCCTTTCATCTCTGGTGAGAAGC
GGAATTACGTTTTTGGTGGCATTAGTGGAATTGCAGCAAATGCGTCCATTAAGGCTTTGGCTGACATGAGATCAATCAAC
CTTTTCGGGGTTCAACAAATATGTCGGAACACTATTGCAGTGGAACAGGCCATGGCAGCTATTCCATATATCGATGGTGA
AACCGTACAACAGAACCTAGATCGTGTCCGTACTTACTTTGAGCTATTAAACATGCCATTCGAAGCATTGCTCGCTTTCA
TAGCAGAACACGACCAAATGTTTACACCCACAGAGTATTCCAATCTTCTGAAGGTCAATGTTCCTGGAAGAGATACTCCT
TCAGATGCTCAATCCCGCCTTTTGGAAATTCTTTCTCATTAA