Details for Arabidopsis Locus AT3G10350

Position : Chr3 ( 5`- 3208239 .. 3211294 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10350

Protein [Map View]
MATLSSYLLSSPPLCKSRFSATSLVSGIDFISFSPRTTLSSSSTVLPAILSLSVKHNRRRNSLQGSNSKVFLFLNLKQDW
ISLASLDFDFDFWVSVKSVASPTETISEFDEMVSGTKRKYYMLGGKGGVGKTSCAASLAVRFANNGHPTLVVSTDPAHSL
SDSFAQDLTGGMLVPVEGPEAPLFALEINPEKAREEFRSASQMNGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPG
LDEAIAISKEFCYSIIVFDTAPTGHTLRLLSLPDFLDASIGKILKLRQKITSATSAIKSVFGKEEKGPDAADKLEKLRER
MVKVRELFRDTESTEFVIVTIPTVMAVSESSRLSASLKKESVPVKRLIVNQLLPPSSSDCKFCSIKRKDQMRALDMIRED
SELSALTLMEAPLVDMEIRGVPALRFLGDIIWK*

DNA
ATGGCGACTCTGTCTTCCTATCTGTTATCTTCTCCTCCTCTATGCAAATCCCGATTCTCGGCAACAAGTCTCGTCTCAGG
AATTGATTTCATCTCTTTCTCTCCTCGAACAACTCTCTCCTCGTCATCCACTGTCTTGCCGGCGATTCTTTCTCTTTCCG
TTAAACATAATCGCCGGAGAAACTCGCTTCAAGGTTCGAATTCTAAAGTTTTCCTTTTTCTTAATCTGAAACAGGATTGG
ATTAGCTTAGCTTCTCTTGATTTTGATTTTGATTTCTGGGTTTCAGTGAAATCAGTAGCTAGCCCAACGGAGACGATTTC
AGAATTCGATGAGATGGTCTCCGGCACGAAACGAAAGTATTACATGCTCGGTGGGAAAGGAGGAGTGGGCAAAACTAGTT
GTGCTGCTTCTTTAGCTGTGAGATTCGCCAACAATGGACACCCAACTCTGGTTGTATCTACAGATCCAGCACATTCCTTG
AGCGATTCTTTTGCTCAGGACTTGACTGGAGGAATGCTTGTCCCTGTAGAAGGACCCGAAGCTCCTTTATTTGCTTTAGA
AATAAACCCTGAGAAGGCTAGGGAAGAGTTTCGTAGTGCCTCGCAGATGAATGGAGGAACTGGGGTGAAAGATTTTATGG
ATGGTATGGGACTTGGAATGCTTGTAGAACAGTTGGGGGAGCTTAAACTTGGAGAATTGCTCGACACACCGCCTCCTGGA
TTGGATGAAGCCATAGCCATTTCTAAGGAATTCTGCTATTCTATAATCGTATTTGATACTGCACCAACGGGTCATACGCT
AAGGCTACTCTCTTTACCTGATTTCTTGGATGCATCCATTGGTAAAATCTTGAAGCTTAGACAGAAAATAACCTCGGCTA
CTTCAGCGATCAAATCAGTTTTTGGGAAAGAAGAAAAGGGGCCTGATGCTGCCGACAAATTGGAAAAACTAAGAGAAAGG
ATGGTTAAAGTTCGCGAGCTTTTCCGTGACACAGAGTCAACAGAATTCGTCATTGTCACTATCCCAACGGTAATGGCTGT
CAGCGAGTCTTCTAGGTTAAGTGCTTCCTTGAAGAAGGAAAGTGTTCCCGTCAAAAGACTCATTGTTAATCAGCTTCTCC
CGCCATCCTCCTCAGATTGCAAATTTTGCTCTATTAAGAGAAAGGACCAAATGCGGGCTCTTGATATGATCCGGGAGGAT
TCAGAACTCTCTGCTTTGACACTGATGGAGGCTCCGCTGGTTGATATGGAGATCAGAGGTGTCCCTGCTCTGCGCTTCTT
GGGCGATATCATTTGGAAATAA