Details for Arabidopsis Locus AT3G10320

Position : Chr3 ( 5`- 3195314 .. 3197346 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10320

Protein [Map View]
MRQNLKKVAQIKVDESKKLFPYVFRVKTSCGNCAKRSKPKLIYLLIFSLISSCFVFAPQLLCFPYPSALFLIDSSIKEIE
NRVSESNIESPKTSQKEESISCDRTGYRSDICFMKGDIRTHSPSSSIFLYTSNDLTTDQVLQEKIKPYTRKWETSIMETI
PELKLVTKDMKLFGDKRKCEVIHEVPAVLFSTGGYTGNLYHEFNDGLIPLYITSKRFNKKVVFVIAEYHKWWEMKYGDVL
SQLSDYSLIDFNKDKRTHCFKEAIVGLRIHGELTVDPSQMQDDGTTINEFRNVLDRAYRPRINRLDRLEEQRFHARLAQR
RKAKRPKLALFSRTGSRGITNEDLMVKMAQRIGFDIEVLRPDRTTELAKIYRVLNSSKVMVGVHGAAMTHFLFMKPGSIF
IQIIPLGTDWAAETYYGEPAKKLGLDYNGYKILPRESSLYEKYDKDDPILKDPNSITKKGWQFTKGIYLNDQKVRLDLHR
FKKLLIDAYAKSIR*

DNA
ATGAGGCAGAATCTGAAAAAAGTAGCACAGATCAAAGTAGACGAATCTAAGAAGCTATTTCCTTATGTCTTCCGGGTTAA
AACTTCTTGTGGGAATTGCGCTAAGAGATCGAAGCCTAAGCTTATCTATCTTCTTATCTTCTCTCTTATCTCAAGTTGCT
TTGTCTTTGCTCCTCAGCTCCTCTGTTTCCCTTACCCCTCTGCTCTGTTTCTCATCGATTCTTCAATTAAAGAGATTGAA
AATCGGGTTTCCGAAAGCAATATAGAATCACCTAAGACGTCACAAAAAGAAGAGAGCATATCTTGTGACAGAACCGGCTA
TCGTTCAGACATCTGTTTCATGAAAGGCGATATCAGAACACACTCTCCTTCCTCCTCCATCTTTCTCTACACCTCGAATG
ATCTCACCACCGATCAGGTCTTGCAAGAAAAAATCAAACCATACACCAGAAAATGGGAAACTAGTATAATGGAAACCATC
CCTGAGCTCAAACTTGTGACAAAAGATATGAAGCTTTTTGGCGACAAGCGTAAATGCGAAGTGATCCATGAAGTACCGGC
CGTGCTATTCTCTACCGGAGGATATACCGGAAACCTCTATCATGAGTTCAACGACGGGCTTATTCCTTTGTATATAACAT
CTAAACGTTTCAACAAAAAGGTTGTCTTTGTGATTGCTGAGTATCACAAGTGGTGGGAGATGAAGTATGGAGATGTTCTC
TCTCAGCTCTCTGATTACTCTCTTATCGACTTCAACAAAGACAAGAGAACTCACTGCTTCAAGGAAGCTATTGTTGGTCT
TAGAATCCATGGTGAGTTAACCGTCGATCCTTCTCAGATGCAAGATGATGGAACAACCATCAATGAGTTCAGAAATGTAC
TTGATCGAGCTTATAGACCACGAATCAACAGACTGGACAGGCTAGAGGAGCAACGATTCCACGCAAGACTAGCACAGAGA
AGAAAGGCTAAGAGGCCAAAACTAGCGTTGTTTTCAAGAACCGGGTCTCGAGGGATAACAAACGAGGACCTGATGGTGAA
AATGGCTCAGAGGATCGGGTTTGACATCGAGGTTTTGAGACCTGACAGAACAACGGAACTGGCAAAGATTTACAGAGTGT
TAAACTCAAGCAAAGTCATGGTTGGGGTACATGGAGCAGCCATGACCCATTTTCTGTTCATGAAACCTGGAAGTATCTTT
ATTCAGATCATTCCACTGGGAACAGATTGGGCAGCAGAGACATATTATGGAGAACCGGCAAAGAAGCTCGGTCTAGACTA
CAATGGTTATAAGATTCTTCCAAGAGAGAGCTCATTGTATGAAAAATATGATAAAGATGATCCAATTCTAAAAGATCCAA
ACAGCATCACTAAGAAAGGATGGCAATTCACAAAGGGGATATACCTGAACGACCAGAAAGTGAGGTTAGATCTCCATAGA
TTCAAGAAGCTTTTGATTGATGCGTATGCAAAATCGATTAGGTGA