Details for Arabidopsis Locus AT3G10300

Position : Chr3 ( 5`- 3186314 .. 3188205 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10300

Protein [Map View]
MSGYPPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYGSSASSPYAVPYGAQPAPYGAPPSAPYASLPGDHN
KPHKEKPHGASYGSPSPGGYGAHPSSGPSDYGGYGGAPQQSGHGGGYGGAPQQSGHGGGYGAPPPQASYGSPFASLVPSA
FPPGTDPNIVACFQAADRDNSGFIDDKELQGALSSYNQSFSIRTVHLLMYLFTNSNVRKIGPKEFTSLFFSLQNWRSIFE
RFDKDRSGRIDTNELRDALMSLGFSVSPVILDLLVSKFDKSGGRNRAIEYDNFIECCLTVKGLTEKFKEKDTALSGSAIF
NYENFMLTVLPFLVA*

DNA
ATGTCTGGTTATCCTCCATCAAGCCAAGGTTACGGTTACGGCGGTAATCCACCACCTCCTCAGCCACCGTACGGATCAAC
CGGCAATAACCCTCCTCCGTACGGATCATCCGGCAGCAATCCTCCTCCTCCGTACGGATCATCAGCCTCCTCACCGTACG
CAGTTCCCTACGGAGCTCAGCCCGCTCCTTACGGTGCACCACCGTCAGCACCGTACGCGTCTCTTCCAGGAGACCATAAT
AAGCCGCACAAAGAGAAACCTCACGGCGCCTCCTACGGATCTCCATCTCCCGGTGGCTACGGTGCTCATCCATCGTCTGG
ACCTTCCGACTACGGTGGTTACGGAGGAGCGCCGCAGCAGTCTGGACATGGAGGAGGTTACGGAGGAGCGCCGCAGCAGT
CTGGACATGGAGGAGGTTACGGAGCTCCTCCTCCGCAAGCTTCTTATGGAAGTCCGTTTGCGTCTCTGGTTCCGTCGGCG
TTTCCTCCCGGAACAGATCCGAACATTGTGGCTTGTTTCCAAGCTGCGGATCGGGACAATAGTGGATTCATCGATGATAA
GGAGCTTCAAGGAGCTCTATCTTCGTATAATCAGAGCTTCAGCATAAGAACTGTTCATCTCCTTATGTATCTATTCACCA
ACAGCAATGTCAGGAAGATTGGACCAAAAGAGTTTACTTCACTTTTCTTTAGTCTTCAGAATTGGAGGTCTATCTTTGAG
AGGTTTGATAAGGACAGAAGCGGTAGAATAGATACAAACGAGCTGAGAGATGCACTCATGAGCCTTGGGTTTTCTGTTTC
TCCTGTGATTTTGGATCTGCTGGTTTCAAAGTTTGACAAAAGCGGAGGCAGGAACAGGGCTATCGAATATGACAATTTCA
TCGAGTGTTGTTTGACTGTAAAGGGGCTCACCGAGAAGTTCAAGGAGAAGGATACGGCGTTATCAGGCTCAGCTATTTTC
AATTACGAGAACTTCATGCTCACTGTTTTACCATTCCTCGTCGCTTGA