Details for Arabidopsis Locus AT3G10250

Position : Chr3 ( 5`- 3167951 .. 3170931 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10250

Protein [Map View]
MSSGTVRRVSRQDIQLVQNLIERCLQLYMNQKEVVDTLLEQAKIEPGFTELVWQKLEEENREFFKAYYLRLMVKHQIMEF
NKLLEQQVHHMRQMHPTGVASVQNTNGSHLQSMNQKQLCYPSEHTDQSLKSESAHHPMASSLSNAFLNGSSTLNTNVPSS
INISTHARRVDASPNMLSSQTTNMPMMQGMNGGMIKSETAFTNPASFMYGGERNALEGHSAVGDTSIPNFSNESNNQPLS
DPLLEAEASTFGFLGQIPRNFSLSDLTADFSQSSEILESYDRSPFLVPNAENFLDSRDRGEYQGDNKRLDTISEGFSYDN
IGSE*

DNA
ATGTCGAGTGGAACAGTGAGAAGGGTTTCACGTCAAGATATACAACTGGTTCAAAACCTTATAGAACGATGCCTTCAACT
TTACATGAATCAGAAAGAAGTTGTGGATACTTTACTAGAGCAGGCTAAAATCGAGCCTGGGTTCACAGAACTAGTTTGGC
AGAAGCTTGAAGAAGAGAATCGGGAGTTTTTCAAAGCTTACTATCTTAGGCTAATGGTTAAACACCAGATAATGGAATTC
AACAAGTTGCTTGAGCAGCAGGTTCACCACATGCGTCAGATGCATCCAACTGGTGTTGCTTCTGTCCAAAACACAAATGG
TTCTCATCTTCAATCAATGAATCAGAAACAATTATGCTATCCCTCTGAGCACACTGACCAATCTTTGAAGTCTGAAAGTG
CACATCATCCAATGGCTTCTAGTCTGTCTAATGCATTCCTCAATGGCTCTTCCACACTCAATACAAACGTGCCCTCTTCT
ATAAACATATCAACCCATGCTAGGAGAGTTGATGCTTCTCCAAATATGCTCTCATCGCAGACCACAAACATGCCTATGAT
GCAAGGAATGAATGGAGGAATGATCAAGTCTGAGACTGCCTTTACAAACCCTGCTTCATTCATGTATGGTGGCGAACGGA
ATGCCCTCGAAGGACATTCGGCAGTTGGGGATACTTCGATTCCTAATTTCAGTAACGAGTCCAACAACCAACCCCTCAGT
GATCCGCTTCTTGAAGCAGAAGCTTCTACTTTTGGGTTCTTAGGTCAAATTCCTCGTAACTTTAGCCTCTCTGATTTGAC
TGCTGATTTTTCTCAGAGCTCAGAGATTCTGGAGAGCTACGATAGATCACCCTTCCTTGTGCCGAATGCTGAAAACTTCC
TGGACTCCCGTGACAGAGGAGAATATCAAGGAGACAACAAGAGATTGGATACCATATCTGAAGGTTTCAGTTACGATAAC
ATCGGGAGCGAGTAG