Details for Arabidopsis Locus AT3G10230

Position : Chr3 ( 5`- 3164075 .. 3166038 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10230

Protein [Map View]
MDTLLKTPNKLDFFIPQFHGFERLCSNNPYHSRVRLGVKKRAIKIVSSVVSGSAALLDLVPETKKENLDFELPLYDTSKS
QVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSR
PYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAY
GIVAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLRMEDIQERMAARLK
HLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLS
AEVWRDLWPIERRRQREFFCFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVFGLSLFSHASNTSRLE
IMTKGTVPLAKMINNLVQDRD*

DNA
ATGGATACTCTGTTGAAAACACCCAACAAGCTCGATTTTTTCATCCCTCAGTTTCATGGGTTTGAGAGATTATGCAGTAA
CAATCCATACCATTCAAGGGTTAGGCTTGGTGTGAAGAAAAGGGCTATCAAAATTGTCTCTAGTGTAGTGAGTGGTAGCG
CTGCTCTTTTGGATCTTGTTCCTGAAACTAAGAAGGAGAATCTTGACTTTGAGCTTCCTTTGTACGACACTTCCAAGAGT
CAAGTTGTTGATTTGGCTATTGTTGGTGGTGGTCCTGCTGGTTTAGCCGTGGCTCAGCAGGTTTCTGAAGCTGGACTCTC
TGTTTGTTCCATTGATCCTTCTCCTAAGCTCATATGGCCTAACAATTATGGAGTTTGGGTTGATGAGTTTGAGGCTATGG
ATTTACTAGACTGCCTGGATACCACATGGTCTGGTGCTGTTGTCTATGTCGATGAAGGTGTCAAGAAGGATTTGAGCCGG
CCTTATGGGAGAGTTAACCGGAAACAGCTCAAATCCAAAATGCTTCAGAAATGTATTACCAACGGTGTTAAATTTCATCA
GTCTAAGGTCACTAATGTGGTTCACGAGGAGGCAAACTCCACTGTGGTCTGCAGTGACGGTGTAAAGATTCAGGCTTCCG
TGGTTCTTGATGCCACTGGGTTTTCCCGATGCTTGGTTCAGTATGACAAACCTTACAACCCTGGGTACCAAGTAGCTTAC
GGGATTGTAGCTGAAGTTGATGGTCACCCATTCGATGTAGACAAAATGGTGTTCATGGATTGGAGAGACAAACATCTGGA
CTCATATCCTGAGCTGAAAGAACGGAACAGCAAGATCCCAACGTTCTTGTACGCTATGCCATTTTCTTCCAACCGAATAT
TTCTTGAAGAAACTTCTTTAGTTGCTAGACCTGGTCTGAGAATGGAAGATATCCAAGAAAGAATGGCTGCTAGACTGAAA
CATCTGGGGATCAATGTGAAGAGGATTGAGGAAGACGAGCGTTGTGTGATCCCGATGGGCGGTCCTTTACCAGTCTTACC
TCAACGGGTTGTGGGGATTGGTGGGACAGCAGGAATGGTTCATCCTTCAACTGGTTACATGGTTGCTAGGACTCTTGCAG
CTGCACCAATAGTTGCAAATGCCATTGTGAGATACCTCGGTTCACCAAGTAGTAATAGCCTGAGAGGAGATCAACTCTCT
GCTGAGGTTTGGAGAGACTTGTGGCCTATCGAACGGCGTAGACAGAGGGAGTTCTTCTGTTTTGGAATGGATATTCTGCT
GAAACTCGATTTAGACGCTACTAGAAGGTTCTTTGATGCATTCTTTGATCTGCAACCTCATTACTGGCACGGATTCTTGT
CTTCCAGGCTGTTTCTCCCGGAACTGTTGGTCTTCGGGTTGTCGCTCTTCTCACACGCTTCCAATACCTCAAGATTGGAG
ATCATGACAAAGGGGACTGTTCCTCTTGCTAAGATGATCAACAATTTGGTACAAGATAGAGACTAA