Details for Arabidopsis Locus AT3G10220

Position : Chr3 ( 5`- 3161757 .. 3164231 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10220

Protein [Map View]
MATSRLQLEGDDSVHLHITHANLKSFSADARFSPQMSVEAVKEKLWKKCGTSVNSMALELYDDSGSKVAVLSDDSRPLGF
FSPFDGFRLHIIDLDPSSVTTGGWLEDTSLVEKYNISEEDYAKRTDSFRKFKEKRVSQNPVAAEAKTKENYMEDLCANIK
VGDRCQVEPGEKRGMVKYVGRAESLGPGYWVGIQYDEPLGKHDGMVKGTRFFECPRLQGGMVRPDKVKVGDYPERDPFEE
DEI*

DNA
ATGGCAACTTCGCGTTTACAGTTGGAAGGAGATGACTCTGTACATCTACACATTACTCACGCCAACCTTAAAAGCTTCTC
TGCGGACGCTCGTTTCTCTCCGCAAATGAGTGTAGAAGCTGTGAAAGAAAAGCTATGGAAGAAATGTGGTACATCTGTTA
ATTCCATGGCTTTAGAGCTCTATGATGACTCTGGCTCAAAGGTTGCAGTTCTCAGTGATGATTCTAGACCTCTTGGTTTC
TTCTCTCCTTTTGATGGGTTTCGGTTACACATCATAGATCTTGACCCCTCCTCGGTCACAACTGGAGGCTGGCTTGAAGA
TACGTCACTGGTTGAGAAGTATAACATCTCAGAGGAGGATTATGCTAAACGAACTGACAGTTTTAGGAAATTCAAAGAAA
AGAGAGTTTCTCAAAATCCGGTTGCTGCTGAGGCTAAGACGAAAGAGAACTATATGGAAGATCTCTGCGCAAATATCAAG
GTGGGAGATAGATGCCAAGTTGAGCCTGGGGAGAAAAGAGGAATGGTCAAATATGTTGGACGAGCAGAGTCGTTGGGTCC
TGGCTATTGGGTTGGAATTCAGTATGATGAGCCCCTTGGAAAACATGATGGCATGGTGAAAGGAACAAGATTCTTTGAGT
GCCCTCGGCTTCAAGGTGGTATGGTCAGGCCTGACAAAGTAAAGGTTGGTGATTATCCGGAAAGAGACCCTTTCGAGGAA
GATGAAATATAA