Details for Arabidopsis Locus AT3G10195

Position : Chr3 ( 5`- 3156551 .. 3157011 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10195

Protein [Map View]
MEKISAFFVILFLVSSCLVTMSVGDICQTDRDCVEIGIPRCKRTGKMPICYNGYCCCICSAKRLPASTTRKPPSPSTSKL
V*

DNA
ATGGAGAAAATTTCAGCATTCTTCGTCATTCTCTTCCTTGTCTCGTCGTGCTTGGTGACAATGAGTGTTGGAGATATATG
TCAAACGGATAGAGATTGTGTTGAGATTGGGATTCCAAGATGTAAGAGAACAGGAAAGATGCCGATTTGTTACAACGGAT
ATTGTTGTTGTATCTGTTCTGCTAAAAGACTTCCTGCTTCTACTACTCGAAAACCTCCTTCTCCATCAACCTCAAAATTA
GTCTGA