Details for Arabidopsis Locus AT3G10185

Position : Chr3 ( 5`- 3145579 .. 3146199 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10185

Protein [Map View]
MATKLSIIVFSIVVLHLLLSAHMHFLINVCAECETKSAIPPLLECGPRCGDRCSNTQYKKPCLFFCNKCCNKCLCVPPGT
YGNKQVCPCYNNWKTKSGGPKCP*

DNA
ATGGCAACAAAACTTAGCATCATTGTTTTCTCCATTGTTGTGTTACATCTTCTTCTGTCTGCCCATATGCATTTTTTAAT
TAATGTTTGTGCTGAATGCGAAACTAAATCCGCTATTCCACCTTTATTAGAGTGCGGGCCAAGGTGTGGAGATAGATGCT
CGAATACACAATACAAGAAGCCGTGTTTGTTCTTCTGCAACAAATGTTGTAACAAGTGCTTGTGTGTGCCCCCAGGTACT
TATGGCAATAAGCAAGTATGTCCTTGCTATAACAACTGGAAGACCAAGAGCGGTGGACCAAAATGCCCTTAG