Details for Arabidopsis Locus AT3G10160

Position : Chr3 ( 5`- 3139383 .. 3144523 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10160

Protein [Map View]
MLVCGKGFLKCRAPGVPFFCDKRKSFFTKTKRGFHSLPLGTGVRVYFNNNLRYSSNSIEVVEKAAINMGSKEDKADNPAL
SSYDDAMEALSTLISRRNRGDRTPTKGNRDKLEQVVTYLKILDLEDKIKELKVIHVAGTKGKGSTCVFSEAILRNCGFRT
GMFTSPHLIDVRERFRIDGLDISEEKFLQYFWECWKLLKEKAVDGLTMPPLFQFLTVLAFKIFVCEKVDVAVIEVGLGGK
LDSTNVIQKPVVCGIASLGMDHMDILGNTLADIAFHKAGIFKPQIPAFTVPQLSEAMDVLQKTANNLEVPLEVVAPLEPK
KLDGVTLGLSGDHQLVNAGLAVSLSRCWLQRTGNWKKIFPNESKETEIPVAFCRGLATARLHGRAQVVHDVVSDPQDSSD
SMETPCGDLIFYLDGAHSPESMEACGRWFSSAVRGDKSLSTAVNGYMRHGEYGTDLNRVSKQILLFNCMEVRDPQVLLPK
LVTTCASSGTHFSRALFVPSMSTYNKVISGASAIPSDTRRKDLTWQFRLQRLWEKSIQGTDAGLDHTLKPDGITALPPHD
FLCGDAPQCGGPAGTPVTSSAVMPSLPLTINWLRDCVRRNPSLKLEVLVTGSLHLVGDVLRLLKR*

DNA
ATGCTCGTTTGTGGGAAAGGGTTTCTAAAGTGCAGAGCACCTGGAGTTCCATTCTTTTGTGACAAAAGAAAATCCTTCTT
CACTAAAACTAAGAGGGGCTTTCACAGTTTACCTTTGGGCACTGGGGTCCGTGTTTATTTCAACAACAATCTTAGGTACT
CAAGCAATTCAATAGAAGTTGTGGAGAAAGCTGCCATTAATATGGGTTCAAAGGAAGACAAGGCAGATAATCCAGCTTTA
TCTTCATATGATGATGCCATGGAAGCTCTGTCGACTCTTATTTCTCGTCGAAACCGTGGGGATCGCACACCTACTAAAGG
AAATCGTGACAAGCTTGAACAAGTCGTCACATATCTCAAGATTTTGGACCTGGAAGACAAAATAAAAGAACTAAAAGTTA
TTCATGTCGCAGGAACAAAAGGAAAGGGTTCAACATGTGTCTTCAGTGAGGCAATTTTACGTAATTGTGGGTTTCGAACC
GGAATGTTTACATCTCCTCACTTGATTGATGTGAGGGAAAGATTCCGAATAGATGGCTTGGATATATCTGAGGAAAAGTT
TCTACAGTACTTCTGGGAATGTTGGAAGTTATTGAAGGAGAAAGCTGTAGATGGTCTTACCATGCCTCCTCTTTTTCAGT
TTCTCACAGTATTGGCATTTAAGATTTTTGTTTGTGAAAAGGTTGATGTTGCTGTCATTGAAGTTGGACTTGGGGGAAAA
CTTGACTCGACAAATGTGATTCAAAAACCTGTTGTCTGTGGCATTGCTTCTCTTGGGATGGATCATATGGACATATTGGG
AAATACGCTAGCTGATATTGCCTTTCATAAGGCTGGGATTTTCAAGCCTCAAATCCCCGCCTTCACAGTACCACAACTCT
CTGAAGCAATGGATGTTCTTCAGAAAACAGCTAATAATCTCGAGGTTCCTCTAGAAGTAGTAGCGCCTCTTGAACCTAAA
AAGTTGGACGGAGTTACGCTTGGCTTGTCTGGGGATCATCAGCTAGTAAATGCAGGTCTTGCTGTTTCTCTTTCAAGATG
CTGGCTTCAAAGAACCGGGAATTGGAAGAAGATATTTCCAAATGAAAGCAAGGAAACTGAGATTCCCGTGGCATTTTGTC
GTGGTCTTGCAACGGCACGTCTTCATGGGAGAGCTCAAGTTGTTCATGATGTAGTTTCAGATCCGCAGGACTCATCAGAC
TCGATGGAAACTCCATGCGGTGATCTGATCTTTTACTTGGATGGTGCTCACAGTCCAGAGAGCATGGAGGCTTGTGGTCG
ATGGTTCTCTTCTGCAGTCAGAGGAGACAAAAGCTTATCCACTGCTGTCAATGGTTACATGAGACATGGGGAGTATGGTA
CAGACTTAAACAGAGTCTCCAAACAGATTCTTCTGTTCAACTGCATGGAAGTGAGAGACCCTCAAGTCTTACTTCCAAAG
CTGGTCACCACTTGCGCTTCCTCAGGCACTCATTTCTCAAGAGCGCTTTTTGTCCCGAGCATGTCTACTTACAACAAAGT
CATTTCGGGTGCATCAGCGATTCCTTCAGATACACGTAGAAAGGATTTGACTTGGCAATTCAGACTACAAAGACTATGGG
AGAAATCAATCCAAGGGACTGATGCGGGGCTTGACCATACACTGAAACCCGATGGAATAACCGCCTTACCACCTCATGAT
TTCCTGTGCGGAGATGCACCTCAATGTGGTGGACCTGCAGGGACACCGGTCACTTCCAGTGCCGTAATGCCTTCACTTCC
ATTGACTATAAACTGGCTAAGAGACTGCGTACGCCGAAACCCTTCACTGAAACTAGAGGTTCTGGTCACAGGATCGCTAC
ATCTTGTTGGAGATGTGCTCAGGTTGCTAAAGAGATGA