Details for Arabidopsis Locus AT3G10140

Position : Chr3 ( 5`- 3134873 .. 3137417 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10140

Protein [Map View]
MGRLSWASPIQRFRFFSYLSQLNGRRSVLACSGYENRYLSSLVEASDCELDEVPDDRKVAEKDTALHLALSQLSGDFDKD
SKLSLQRFYRKRRVSVISTGSLNLDLALGVGGLPKGRMVEVYGKEASGKTTLALHIIKEAQKLGGYCAYLDAENAMDPSL
AESIGVNTEELLISRPSSAEKMLNIVDVLTKSGSVDVIVVDSVAALAPQCELDAPVGERYRDTQSRIMTQALRKIHYSVG
YSQTLIVFLNQVRSHVKSNMHFPHAEEVTCGGNALPFHAAIRLKMIRTGLIKTANKISGLNVCVQVVKNKLAPGKKKSEL
GIHFGHGFYVEREVLELACEHGVILREGTSYFIEGEVIEGKDAAEKYLVENKEALDTVVAILRNQLFKM*

DNA
ATGGGTCGACTCTCATGGGCCAGTCCGATTCAGAGATTCCGTTTCTTCTCTTACTTATCTCAGCTGAATGGAAGAAGAAG
CGTTTTGGCTTGCTCTGGCTATGAAAATCGTTATCTTTCGTCTTTAGTTGAAGCTTCAGATTGTGAACTTGATGAAGTTC
CAGATGATAGAAAAGTAGCGGAGAAAGACACTGCTCTACATTTAGCATTGTCACAGCTTTCAGGTGATTTTGATAAAGAC
TCTAAGTTGTCATTGCAGCGGTTTTACAGAAAAAGGAGAGTTTCTGTGATATCCACGGGTTCCCTCAACCTTGATCTAGC
TCTTGGAGTTGGAGGATTGCCAAAGGGAAGAATGGTTGAGGTTTACGGAAAAGAAGCATCTGGAAAGACAACTCTAGCTC
TGCATATCATCAAGGAAGCTCAAAAGCTTGGAGGTTATTGCGCTTATCTTGATGCAGAGAATGCCATGGATCCTTCTCTA
GCAGAATCAATAGGTGTGAACACAGAAGAGCTTCTGATATCACGACCTAGTTCTGCTGAAAAGATGCTAAATATTGTTGA
TGTGCTGACCAAGAGTGGGTCAGTAGACGTAATTGTGGTAGACAGTGTTGCTGCTCTTGCCCCTCAATGTGAACTTGATG
CTCCTGTAGGAGAAAGATACAGAGACACACAATCAAGAATAATGACACAGGCGCTCAGAAAAATCCATTACTCAGTTGGC
TATTCTCAGACACTGATCGTTTTTCTTAATCAGGTCAGATCACATGTGAAATCTAACATGCATTTCCCGCACGCCGAAGA
AGTGACTTGTGGAGGAAACGCATTACCGTTTCATGCAGCTATACGTCTCAAAATGATAAGAACCGGGCTAATAAAGACTG
CCAATAAGATAAGTGGTCTCAATGTCTGCGTCCAAGTGGTGAAGAATAAACTGGCGCCCGGAAAGAAGAAATCTGAATTG
GGGATTCACTTTGGTCATGGTTTCTACGTGGAGCGAGAGGTATTAGAATTGGCTTGTGAGCATGGAGTTATCTTAAGAGA
AGGAACTAGCTATTTCATTGAAGGCGAGGTCATTGAAGGGAAAGACGCAGCTGAGAAGTATCTGGTGGAAAATAAAGAGG
CTCTCGATACTGTCGTTGCAATCCTGAGGAACCAGCTCTTCAAGATGTGA