Details for Arabidopsis Locus AT3G10130

Position : Chr3 ( 5`- 3130998 .. 3133192 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10130

Protein [Map View]
MMMISSSSITSSLSLLSSSPEKLPLINPIQRCPITYSGFRTASVNRAIRRQPQSPAVSATESRVSLVLALASQASSVSQR
LLADLAMETAKYVFPKRFDSSTNLEEAFMSVPDLETMNFRVLFRTDKYEIRQVEPYFVAETIMPGETGFDSYGASKSFNV
LAEYLFGKNTIKEKMEMTTPVVTRKVQSVGEKMEMTTPVITSKAKDQNQWRMSFVMPSKYGSNLPLPKDPSVKIQQVPRK
IVAVVAFSGYVTDEEIERRERELRRALQNDKKFRVRDGVSFEVAQYNPPFTLPFMRRNEVSLEVENKED*

DNA
ATGATGATGATCAGCTCCTCCTCCATTACATCATCCCTTTCTCTTCTGTCTTCATCTCCTGAGAAATTGCCCCTCATAAA
CCCTATCCAGAGATGCCCAATTACTTACTCCGGCTTCAGAACGGCGAGCGTGAACAGAGCTATCCGGCGGCAGCCGCAGA
GTCCAGCCGTGTCCGCCACTGAATCTAGGGTTTCTCTCGTCCTTGCTCTCGCCTCTCAAGCTTCCTCTGTCTCTCAACGC
CTTTTGGCTGATTTGGCGATGGAGACTGCGAAATATGTGTTTCCCAAGAGATTTGATAGCTCTACTAATCTTGAAGAAGC
TTTCATGTCTGTTCCGGATCTCGAGACAATGAACTTTAGAGTTCTATTTAGAACAGACAAGTACGAGATTAGACAAGTTG
AGCCTTATTTTGTGGCCGAGACTATAATGCCAGGGGAAACTGGATTTGACTCTTATGGTGCTTCCAAGTCTTTTAATGTT
TTAGCTGAGTACCTCTTTGGTAAGAACACAATAAAGGAGAAAATGGAGATGACGACCCCTGTTGTTACTCGGAAAGTCCA
ATCTGTTGGAGAGAAGATGGAAATGACAACTCCAGTGATAACTAGCAAGGCAAAAGATCAAAACCAGTGGCGGATGTCTT
TTGTCATGCCCTCAAAGTATGGTTCGAATTTGCCATTACCAAAAGATCCTTCAGTCAAAATTCAGCAAGTGCCACGAAAG
ATTGTTGCTGTTGTCGCCTTCTCAGGCTATGTTACCGATGAAGAGATTGAGAGACGGGAGAGAGAACTAAGGAGAGCTCT
TCAAAATGACAAGAAGTTCCGAGTGAGAGATGGAGTATCATTTGAAGTTGCACAGTATAATCCACCATTCACTCTCCCGT
TTATGCGCCGCAACGAGGTCTCTCTCGAAGTTGAAAACAAAGAAGATTAG