Details for Arabidopsis Locus AT3G10116

Position : Chr3 ( 5`- 3126023 .. 3126619 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10116

Protein [Map View]
MNETRGGYTANVTIFNYLKYHDIEGPWVLDWIWEDQILLSTVGVQSSNFTIYPDDRNRVMIVELPPQTDDNDDQLIIPTS
SKDGGIPRFREEHDDLAKSSFTFQIDVGRANLKYHLPAIDHVALTTPRGTYICDKLMKVTQTPGYLSKLVEHELRSVAAL
GRWEWGHLPQ*

DNA
ATGAATGAAACTCGAGGTGGTTACACGGCTAACGTTACAATCTTCAACTACTTGAAGTATCACGACATTGAAGGACCATG
GGTGTTAGATTGGATATGGGAAGACCAAATCCTATTGAGCACTGTAGGTGTTCAAAGTAGTAATTTTACGATATACCCGG
ACGACAGAAATAGGGTTATGATTGTGGAGTTACCGCCACAAACTGATGATAATGATGACCAGCTAATCATACCAACTTCT
AGCAAGGACGGTGGGATTCCTAGGTTTAGAGAAGAACATGACGACCTTGCAAAAAGCTCTTTTACGTTCCAAATTGATGT
TGGCCGAGCTAATCTAAAATATCATCTTCCGGCAATTGATCATGTAGCTCTGACCACACCAAGAGGGACATACATATGTG
ATAAATTGATGAAAGTTACTCAAACTCCGGGTTATCTGAGTAAACTCGTGGAGCACGAGTTGCGGTCAGTGGCGGCGCTA
GGTAGATGGGAGTGGGGTCACTTGCCCCAGTAA