Details for Arabidopsis Locus AT3G10050

Position : Chr3 ( 5`- 3098725 .. 3101761 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10050

Protein [Map View]
MNSVQLPTAQSSLRSHIHRPSKPVVGFTHFSSRSRIAVAVLSRDETSMTPPPPKLPLPRLKVSPNSLQYPAGYLGAVPER
TNEAENGSIAEAMEYLTNILSTKVYDIAIESPLQLAKKLSKRLGVRMYLKREDLQPVFSFKLRGAYNMMVKLPADQLAKG
VICSSAGNHAQGVALSASKLGCTAVIVMPVTTPEIKWQAVENLGATVVLFGDSYDQAQAHAKIRAEEEGLTFIPPFDHPD
VIAGQGTVGMEITRQAKGPLHAIFVPVGGGGLIAGIAAYVKRVSPEVKIIGVEPADANAMALSLHHGERVILDQVGGFAD
GVAVKEVGEETFRISRNLMDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGANMN
FDKLRIVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPMNISEFKYRCSSEKEAVVLYSVGVHTAGELKALQKRMES
SQLKTVNLTTSDLVKDHLRYLMGGRSTVGDEVLCRFTFPERPGALMNFLDSFSPRWNITLFHYRGQGETGANVLVGIQVP
EQEMEEFKNRAKALGYDYFLVSDDDYFKLLMH*

DNA
ATGAATTCCGTTCAGCTTCCGACGGCGCAATCCTCTCTCCGTAGCCACATTCACCGTCCATCAAAACCAGTGGTCGGATT
CACTCACTTCTCCTCCCGTTCTCGGATCGCAGTGGCGGTTCTGTCCCGAGATGAAACATCTATGACTCCACCGCCTCCAA
AGCTTCCTTTACCACGTCTTAAGGTCTCTCCGAATTCGTTGCAATACCCTGCCGGTTACCTCGGTGCTGTACCAGAACGT
ACGAACGAGGCTGAGAACGGAAGCATCGCGGAAGCTATGGAGTATTTGACGAATATACTGTCCACTAAGGTTTACGACAT
CGCCATTGAGTCACCACTCCAATTGGCTAAGAAGCTATCTAAGAGATTAGGTGTTCGTATGTATCTTAAAAGAGAAGACT
TGCAACCTGTATTCTCGTTTAAGCTTCGTGGAGCTTACAATATGATGGTGAAACTTCCAGCAGATCAATTGGCAAAAGGA
GTTATCTGCTCTTCAGCTGGAAACCATGCTCAAGGAGTTGCTTTATCTGCTAGTAAACTCGGCTGCACTGCTGTGATTGT
TATGCCTGTTACGACTCCTGAGATAAAGTGGCAAGCTGTAGAGAATTTGGGTGCAACGGTTGTTCTTTTCGGAGATTCGT
ATGATCAAGCACAAGCACATGCTAAGATACGAGCTGAAGAAGAGGGTCTGACGTTTATACCTCCTTTTGATCACCCTGAT
GTTATTGCTGGACAAGGGACTGTTGGGATGGAGATCACTCGTCAGGCTAAGGGTCCATTGCATGCTATATTTGTGCCAGT
TGGTGGTGGTGGTTTAATAGCTGGTATTGCTGCTTATGTGAAGAGGGTTTCTCCCGAGGTGAAGATCATTGGTGTAGAAC
CAGCTGACGCAAATGCAATGGCTTTGTCGCTGCATCACGGTGAGAGGGTGATATTGGACCAGGTTGGGGGATTTGCAGAT
GGTGTAGCAGTTAAAGAAGTTGGTGAAGAGACTTTTCGTATAAGCAGAAATCTAATGGATGGTGTTGTTCTTGTCACTCG
TGATGCTATTTGTGCATCAATAAAGGATATGTTTGAGGAGAAACGGAACATATTGGAACCAGCAGGGGCTCTTGCACTCG
CTGGAGCTGAGGCATACTGTAAATATTATGGCCTAAAGGACGTGAATGTCGTAGCCATAACCAGTGGCGCTAACATGAAC
TTTGACAAGCTAAGGATTGTGACAGAACTCGCCAATGTCGGTAGGCAACAGGAAGCTGTTCTTGCTACTCTCATGCCGGA
AAAACCTGGAAGCTTTAAGCAATTTTGTGAGCTGGTTGGACCAATGAACATAAGCGAGTTCAAATATAGATGTAGCTCGG
AAAAGGAGGCTGTTGTACTATACAGTGTCGGAGTTCACACAGCTGGAGAGCTCAAAGCACTACAGAAGAGAATGGAATCT
TCTCAACTCAAAACTGTCAATCTCACTACCAGTGACTTAGTGAAAGATCACCTGCGTTACTTGATGGGAGGAAGATCTAC
TGTTGGAGACGAGGTTCTATGCCGATTCACCTTTCCCGAGAGACCTGGTGCTCTAATGAACTTCTTGGACTCTTTCAGTC
CACGGTGGAACATCACCCTTTTCCATTACCGTGGACAGGGTGAGACGGGCGCGAATGTGCTGGTCGGGATCCAAGTCCCC
GAGCAAGAAATGGAGGAATTTAAAAACCGAGCTAAAGCTCTTGGATACGACTACTTCTTAGTAAGTGATGACGACTATTT
TAAGCTTCTGATGCACTGA