Details for Arabidopsis Locus AT3G10000

Position : Chr3 ( 5`- 3076781 .. 3078947 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G10000

Protein [Map View]
MEDHQNHPQYGIEQPSSQFSSDLFGFNLVSAPDQHHRLHFTDHEISLLPRGIQGLTVAGNNSNTITTIQSGGCVGGFSGF
TDGGGTGRWPRQETLMLLEVRSRLDHKFKEANQKGPLWDEVSRIMSEEHGYTRSGKKCREKFENLYKYYKKTKEGKSGRR
QDGKNYRFFRQLEAIYGESKDSVSCYNNTQFIMTNALHSNFRASNIHNIVPHHQNPLMTNTNTQSQSLSISNNFNSSSDL
DLTSSSEGNETTKREGMHWKEKIKEFIGVHMERLIEKQDFWLEKLMKIVEDKEHQRMLREEEWRRIEAERIDKERSFWTK
ERERIEARDVAVINALQYLTGRALIRPDSSSPTERINGNGSDKMMADNEFADEGNKGKMDKKQMNKKRKEKWSSHGGNHP
RTKENMMIYNNQETKINDFCRDDDQCHHEGYSPSNSKNAGTPSCSNAMAASTKCFPLLEGEGDQNLWEGYGLKQRKENNH
Q*

DNA
ATGGAGGATCATCAAAACCATCCACAGTACGGTATAGAACAACCATCTTCTCAATTCTCCTCTGATCTCTTCGGCTTCAA
CCTCGTTTCAGCGCCGGACCAGCACCATCGTCTTCATTTCACCGACCATGAGATAAGTTTATTGCCACGTGGAATACAAG
GGCTTACGGTGGCTGGAAACAACAGTAACACTATTACAACGATCCAGAGTGGTGGCTGTGTTGGTGGGTTTAGTGGCTTT
ACGGACGGCGGAGGAACAGGGAGGTGGCCGAGGCAAGAGACGTTGATGTTGTTGGAGGTCAGATCTCGTCTTGATCACAA
GTTCAAAGAAGCTAATCAAAAGGGTCCTCTCTGGGATGAAGTTTCTAGGATTATGTCGGAGGAACATGGATACACTAGGA
GTGGCAAGAAGTGTAGAGAGAAGTTCGAGAATCTCTACAAGTACTATAAAAAAACAAAAGAAGGCAAATCCGGTCGGCGA
CAAGATGGTAAAAACTATAGATTTTTCCGGCAGCTTGAAGCGATATACGGCGAATCCAAAGACTCGGTTTCTTGCTATAA
CAACACGCAGTTCATAATGACCAATGCTCTTCATAGTAATTTCCGCGCTTCTAACATTCATAACATCGTCCCTCATCATC
AGAATCCCTTGATGACCAATACCAATACTCAAAGTCAAAGCCTTAGCATTTCTAACAATTTCAACTCCTCCTCCGATTTG
GATCTAACTTCTTCCTCTGAAGGAAACGAAACTACTAAAAGAGAGGGGATGCATTGGAAGGAAAAGATCAAGGAATTCAT
TGGTGTTCATATGGAGAGGTTGATAGAGAAGCAAGATTTTTGGCTTGAGAAGTTGATGAAGATTGTGGAAGACAAAGAAC
ATCAAAGGATGCTGAGAGAAGAGGAATGGAGAAGGATTGAAGCGGAAAGGATCGATAAGGAACGTTCGTTTTGGACAAAA
GAGAGGGAGAGGATTGAAGCTCGGGATGTTGCGGTGATTAATGCCTTGCAGTACTTGACGGGAAGGGCATTGATAAGGCC
GGATTCTTCGTCTCCTACAGAGAGGATTAATGGGAATGGAAGCGATAAAATGATGGCTGATAATGAATTTGCTGATGAAG
GAAATAAGGGCAAGATGGATAAAAAACAAATGAATAAGAAAAGGAAGGAGAAATGGTCAAGCCACGGAGGGAATCATCCA
AGAACCAAAGAGAATATGATGATATACAACAATCAAGAAACTAAGATTAATGATTTTTGTCGAGATGATGACCAATGCCA
TCATGAAGGTTACTCACCTTCAAACTCCAAGAACGCAGGAACTCCGAGCTGCAGCAATGCCATGGCAGCTAGTACAAAGT
GCTTTCCATTGCTTGAAGGAGAAGGAGATCAGAACTTGTGGGAGGGTTATGGTTTGAAGCAAAGGAAAGAAAATAATCAT
CAGTAA