Details for Arabidopsis Locus AT3G09980

Position : Chr3 ( 5`- 3069231 .. 3071429 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09980

Protein [Map View]
MKEMQAIETSQPTTVAPAVHSRQLGAQLSGSMSFSSQMSKEDEEMSRTALSAFRAKEEEIEKKKMEIRERVQAQLGRVEE
ETKRLALIREELEGLADPMRKEVAMVRKKIDSVNKELKPLGHTVQKKEREYKEALEAFNEKNREKVQLITRLMELVGESE
KMRMKKLEELSKNIDSIH*

DNA
ATGAAGGAGATGCAGGCAATAGAGACGTCGCAGCCGACGACGGTGGCTCCGGCGGTGCATAGCCGACAATTGGGAGCTCA
GTTGTCGGGAAGTATGAGTTTCAGCAGCCAAATGTCGAAGGAAGATGAGGAGATGTCTAGAACTGCGTTATCTGCGTTTA
GAGCGAAAGAAGAAGAGATCGAGAAGAAGAAGATGGAGATTAGGGAAAGGGTTCAAGCTCAGCTTGGTCGTGTCGAAGAA
GAGACTAAGCGTCTTGCTTTGATCCGTGAGGAACTTGAAGGATTAGCTGATCCCATGAGGAAAGAAGTTGCTATGGTTAG
GAAGAAGATTGATTCTGTCAACAAAGAATTAAAGCCATTGGGCCATACAGTTCAGAAAAAGGAACGAGAGTACAAAGAAG
CTCTTGAAGCATTCAACGAAAAGAACAGGGAGAAGGTGCAGCTAATCACCAGGCTAATGGAGTTGGTGGGAGAAAGCGAA
AAGATGAGAATGAAGAAGCTGGAAGAGCTAAGCAAGAACATAGATTCTATACACTGA