Details for Arabidopsis Locus AT3G09950

Position : Chr3 ( 5`- 3060090 .. 3060633 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09950

Protein [Map View]
MGKGGWLLNFLNHAKNQESVENLDKNGAVKAPSSGFKMPLHYPRYTKEDYEEMEEWRLDLLLSEYGLLAFHDNTLHEKRA
FAIDTFIWPHHP*

DNA
ATGGGGAAGGGGGGTTGGCTTCTTAACTTTCTGAACCATGCCAAAAATCAAGAAAGTGTGGAGAATCTTGACAAAAACGG
TGCCGTAAAGGCCCCAAGCAGTGGGTTTAAGATGCCGTTGCATTACCCAAGATACACAAAGGAGGATTATGAAGAGATGG
AAGAGTGGAGATTGGATTTGCTTCTCTCGGAATACGGACTTCTTGCCTTCCATGACAATACTCTCCATGAGAAGCGAGCT
TTTGCAATCGACACTTTTATATGGCCTCATCACCCATAA