Details for Arabidopsis Locus AT3G09925

Position : Chr3 ( 5`- 3051868 .. 3052784 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09925

Protein [Map View]
MAQRITTLVLLIEILFLVSCVTHITTTAAYNNGDKIHVAGKVMCQDCSLNYDEWINGSEPIKGAVVSITCMDERRRVSYY
GSDLTDERGQFDLMVNKVLSHGKVLKPQLCNVRLVSSPDLSCNIPTNFGNGQTGVKLVRPFTVFRDLVKYVVGPFYYTTP
MCETPKFENNY*

DNA
ATGGCGCAGAGGATCACAACATTGGTTCTGCTAATAGAGATATTGTTTCTGGTGAGTTGTGTGACTCATATCACTACGAC
AGCAGCGTATAACAATGGAGATAAGATTCACGTCGCCGGAAAAGTAATGTGTCAAGATTGTTCTCTGAACTACGACGAAT
GGATCAACGGTTCTGAACCCATCAAAGGGGCAGTGGTATCAATCACTTGTATGGACGAAAGGAGAAGAGTGAGCTACTAT
GGCAGCGATTTGACCGATGAGAGAGGCCAGTTCGATCTAATGGTCAACAAAGTCCTCTCCCACGGCAAGGTTCTCAAGCC
TCAACTTTGTAATGTCCGGCTCGTGTCTTCTCCGGACCTGTCATGTAACATTCCCACCAATTTTGGGAACGGTCAAACCG
GAGTGAAGCTAGTTCGACCATTCACAGTTTTCAGGGATCTGGTTAAGTATGTGGTTGGACCATTTTATTATACCACGCCA
ATGTGTGAGACGCCTAAATTTGAAAACAACTACTAA