Details for Arabidopsis Locus AT3G09920

Position : Chr3 ( 5`- 3038780 .. 3044919 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09920

Protein [Map View]
MSGLDVRGAVSFAERTKSVDALTKKEILSALNSGEVSETSEDARFRVRELVLPDGESYSGSLLGNVPEGPGKYIWSDGCV
YDGEWRRGMRHGIGNMRWASGASYDGEFSGGYMHGSGTYVDANKLTYKGRWRLNLKHGLGYQVYPNGDVFEGSWIQGLGE
GPGKYTWANKNVYLGDMKGGKMSGKGTLTWVTGDSYEGSWLNGMMHGVGVYTWSDGGCYVGTWTRGLKDGKGSFYSAGTR
VPVVQEFYLNALRKRGVLPDMRRQNQVASSVNMENLRVGVNRNKLSKGSLINLEQSRNGRVSLERRWSLEVSIEKVIGHG
YSDLSTAVLDSGSSVQYKANIPILEREYMQGVLISELVVNNGFSRTSRRAKRKHKRLVKEAKKPGEVVIKGHRSYDLMLS
LQLGIRYTVGKITPIQRRQVRTADFGPRASFWMTFPRAGSTMTPPHHSEDFKWKDYCPMVFRNLREMFKIDAADYMMSIC
GNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKVLLRMLPDYHHHVKTYENTLITKFFGLHRIKPSSGQKFRFVVM
GNMFFTDLRIHRRFDLKGSSLGRSADKVEIDENTILKDLDLNYSFFLETSWREGLLRQLEIDSKFLEAQNIMDYSLLLGV
HHRAPQHLRSQLVRSQSITTDALESVAEDDTIEDDMLSYHEGLVLVPRGSENTVTGPHIRGSRLRASAVGDEEVDLLLPG
TARLQIQQGVNMPARAELIPGREDKEKQILHDCCDVVLYLGIIDILQEYNMTKKIEHAYKSLHFDSLSISAVDPTFYSQR
FLEFIKKVFPQNNKS*

DNA
ATGTCTGGCCTTGACGTACGAGGAGCAGTTTCTTTTGCTGAAAGAACTAAATCTGTTGATGCACTTACTAAGAAAGAGAT
CCTATCGGCGCTAAACAGTGGAGAAGTTTCCGAAACTTCTGAGGATGCTAGGTTCAGAGTTAGGGAGCTGGTTCTCCCCG
ATGGCGAATCCTACAGTGGTTCTTTGCTTGGAAATGTACCCGAGGGACCAGGGAAGTACATATGGTCAGATGGGTGTGTT
TACGATGGAGAATGGAGGCGTGGGATGAGACATGGAATTGGAAATATGAGATGGGCTTCCGGGGCATCTTATGATGGTGA
ATTTTCAGGCGGTTATATGCACGGTTCAGGGACCTATGTGGATGCTAACAAGTTAACGTATAAAGGAAGATGGCGGCTTA
ATTTGAAACATGGGCTCGGATATCAGGTTTACCCTAATGGAGATGTCTTTGAAGGTTCTTGGATTCAGGGATTGGGAGAA
GGACCAGGGAAGTATACTTGGGCTAATAAAAATGTCTATCTCGGGGATATGAAAGGCGGGAAAATGTCAGGAAAGGGTAC
ACTTACTTGGGTTACCGGAGATTCCTATGAAGGAAGTTGGTTGAATGGAATGATGCATGGTGTTGGTGTATATACGTGGA
GCGATGGAGGTTGCTATGTTGGGACATGGACACGGGGTTTGAAAGACGGTAAAGGCTCGTTTTATTCAGCGGGAACCAGA
GTTCCGGTAGTGCAAGAGTTTTATTTAAATGCTCTTAGAAAGAGAGGTGTTTTGCCAGATATGAGAAGACAGAACCAAGT
TGCTTCCTCGGTTAATATGGAAAACCTTAGAGTTGGTGTGAACCGTAATAAGCTCTCAAAAGGGAGCTTAATAAACTTAG
AACAGTCCCGCAATGGAAGGGTTTCTTTAGAAAGACGTTGGAGTCTTGAAGTATCTATTGAGAAAGTGATTGGACATGGT
TACTCGGATTTATCTACGGCAGTTTTAGATAGCGGAAGTAGTGTGCAGTATAAAGCTAACATACCAATCTTGGAGAGGGA
ATATATGCAAGGTGTTCTGATCAGTGAGCTTGTGGTAAACAACGGGTTTTCGCGCACATCCAGAAGAGCAAAAAGGAAAC
ACAAAAGACTTGTTAAAGAAGCTAAGAAGCCTGGAGAAGTTGTTATTAAAGGTCACCGGAGTTATGATCTGATGCTCAGT
TTGCAGCTTGGAATCAGATACACAGTGGGGAAAATTACGCCAATACAAAGACGACAAGTTCGGACAGCAGACTTTGGACC
TCGGGCTAGTTTTTGGATGACTTTTCCTCGAGCTGGCTCCACGATGACTCCTCCGCACCACTCGGAGGATTTTAAATGGA
AGGACTATTGCCCAATGGTATTCAGAAACCTGAGGGAGATGTTCAAGATCGATGCAGCTGATTATATGATGTCCATTTGT
GGAAATGATACTTTAAGAGAACTTTCTTCTCCAGGGAAGAGCGGCAGCGTCTTCTTCCTGTCGCAGGATGATCGGTTCAT
GATCAAAACACTCAGGAAATCTGAAGTCAAGGTTCTTCTGAGGATGCTTCCAGATTACCATCATCATGTGAAGACATATG
AGAACACCCTCATTACTAAATTCTTTGGCCTTCACAGAATCAAACCATCAAGTGGTCAAAAGTTCCGTTTTGTGGTGATG
GGTAACATGTTCTTTACAGATCTAAGAATCCATCGGAGATTTGACCTTAAAGGTTCGTCCTTGGGACGCTCTGCAGACAA
AGTCGAGATAGACGAGAACACGATACTTAAAGATTTAGATCTGAACTACAGCTTCTTCTTGGAGACTTCTTGGCGGGAAG
GTTTACTGAGGCAACTAGAGATCGATAGCAAGTTCTTGGAAGCACAGAACATAATGGATTACAGTCTTTTGCTCGGTGTG
CATCATCGAGCTCCACAGCACTTAAGATCCCAATTGGTCCGTTCTCAAAGTATAACAACTGATGCTCTGGAAAGTGTAGC
TGAAGATGATACAATCGAGGACGACATGCTGTCTTACCACGAAGGATTGGTTCTCGTTCCTCGGGGAAGTGAAAATACTG
TAACTGGCCCTCACATCAGAGGCAGCAGATTACGAGCATCCGCTGTTGGTGATGAAGAAGTAGATCTCCTTCTTCCTGGA
ACAGCCAGGCTGCAGATACAGCAAGGAGTGAACATGCCGGCAAGAGCAGAGCTGATACCGGGAAGAGAAGATAAAGAGAA
GCAGATTTTACATGACTGCTGCGACGTCGTACTCTACCTTGGCATTATAGACATCTTACAAGAGTACAACATGACCAAGA
AGATTGAACATGCTTATAAATCTCTTCACTTTGATTCTCTTTCGATCTCAGCCGTTGATCCAACATTCTACTCCCAACGT
TTTCTTGAGTTCATCAAGAAAGTATTTCCACAGAACAACAAATCATAG