Details for Arabidopsis Locus AT3G09870

Position : Chr3 ( 5`- 3027424 .. 3027957 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09870

Protein [Map View]
MCKKFKIFMRKLQICCLFTRFSKRVGNYCEFEEEGNAASMIPSDVKEGHVAVIAVKGERIKRFVLELEELNKPEFLRLLE
QAREEFGFQPRGPLTIPCQPEEVQKILQGSRES*

DNA
ATGTGCAAAAAGTTTAAGATTTTCATGAGAAAGCTACAAATTTGCTGCTTATTCACTAGATTCTCTAAAAGGGTAGGGAA
TTATTGTGAGTTTGAGGAAGAGGGTAATGCTGCATCAATGATTCCAAGTGATGTGAAGGAAGGGCATGTAGCAGTGATTG
CGGTTAAGGGAGAGAGAATTAAGAGGTTTGTTTTAGAGCTTGAAGAGTTGAACAAACCAGAGTTCTTGAGGCTGCTCGAA
CAAGCGAGAGAGGAATTCGGGTTTCAACCAAGAGGACCTCTGACCATCCCATGCCAGCCGGAAGAAGTACAGAAGATTCT
ACAAGGAAGTAGAGAGTCTTGA