Details for Arabidopsis Locus AT3G09860

Position : Chr3 ( 5`- 3026055 .. 3027234 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09860

Protein [Map View]
MEKYFGNAYRGDPGVPHADADRFVNIWIGSAAFSVLTWVNPYMWQLSNQFNYHDKWMLFEQYHWKKARAKKQPYEFKWNK
IPKEVRDSYYYNWPVYFP*

DNA
ATGGAGAAGTACTTTGGAAATGCGTACAGGGGAGATCCAGGAGTGCCACATGCAGATGCAGATCGTTTCGTGAATATATG
GATTGGTTCTGCTGCTTTCTCCGTTCTTACCTGGGTTAATCCTTACATGTGGCAGCTCTCTAACCAGTTCAATTACCATG
ACAAGTGGATGCTGTTTGAGCAGTACCACTGGAAAAAAGCAAGGGCAAAGAAGCAACCTTATGAATTCAAGTGGAATAAG
ATACCCAAAGAAGTCAGGGACTCGTACTATTACAACTGGCCAGTCTACTTCCCATAG