Details for Arabidopsis Locus AT3G09850

Position : Chr3 ( 5`- 3023211 .. 3025851 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G09850

Protein [Map View]
MRGGGRRRSNGGGSSGKNKAKSPGQSTRTNHNSAAGSSSGGRHRRQNNTTLFVEGGILSDYRKDPNFSTPSRGGSSSGKG
LRSRSIERVKASASTSGPRKCSGNTYVYQYPSIDFEEGLDRRSGVESDQMNESPLVLGKSEATQIVAFLDQTPSSSKGIK
VSYDYEYEPSYVLGDDSHKGLGFCDDSDATPSGSLSIPKALGDQGGSFSHEEEGDAVDESGGNDDELMPDVVKTPKRRNS
GFISIGGMKLYTEDVSGEESDGEEEMNDDDDDESGDEGSSGSSELSESDSSEDMFGSYSEIDDDVAKDYLEGIGGSEIML
DAHWLAEQSLDKLDLSSDDSSSSDSSDRKTRKLTGIRLQKASMEYGKKKTTRSGYSGHGKSTNPLAMDDLMFVKDPRSLS
GKKNKKKEVAKFPQSWPSRAPKSKNSRSFPGENKKHRKEYIALKRRERMLQRGVDLADINSQLENFVLENVDMHCFQRMH
NRDCSQVRRLADVYRLSSSCNGSGKKSFVTVTRTYQTCMPSASDKLRIEKLIGAGDEDCDFAVSGGVKGKSGSLDRKKAK
DSAKKRPTREERERNKSNGKKSSYADQPVSFVSSGIIDSEIAVAKTSVEKVAKEVAETTPGTSNGADIGAFEVHTRGFGS
KMMAKMGFIDGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFSIDTEDPSPSSNNNNNAKRNRSSSSGKHGKRITHDNGASG
SGRIRDKRLGAFEQHTTGFGSRMMARMGFVEGSGLGRESQGIVNPLVAVRRPRARGIGAEG*

DNA
ATGCGAGGCGGTGGTAGGAGAAGGTCAAACGGTGGTGGTAGTTCTGGCAAAAACAAGGCTAAATCTCCAGGACAGAGCAC
GAGAACCAATCATAATTCCGCGGCGGGGTCTTCCTCCGGTGGTCGTCACCGACGTCAGAATAATACTACTTTGTTTGTTG
AAGGAGGTATTCTCTCCGACTACCGAAAAGATCCTAACTTTTCGACGCCATCTCGTGGAGGAAGCTCTTCGGGAAAGGGA
TTGAGATCTAGAAGCATAGAGCGTGTAAAAGCTTCTGCTTCCACGAGTGGTCCAAGGAAATGCAGTGGTAATACTTATGT
GTATCAATATCCTTCCATTGATTTTGAGGAAGGTTTGGATCGAAGATCAGGAGTTGAAAGTGATCAAATGAATGAAAGTC
CACTGGTGTTGGGGAAGTCAGAGGCGACTCAAATTGTTGCATTTCTGGATCAAACGCCTTCGTCATCGAAAGGGATTAAG
GTAAGTTATGATTACGAATACGAACCGAGTTACGTTTTGGGTGATGATTCTCATAAAGGATTGGGATTTTGTGATGATTC
TGATGCTACACCAAGTGGTAGCCTTTCTATTCCAAAGGCTTTGGGAGATCAAGGTGGTTCATTTTCCCATGAGGAGGAGG
GTGATGCTGTTGACGAATCTGGTGGAAATGACGATGAACTGATGCCTGATGTTGTGAAAACACCGAAAAGGAGGAATTCA
GGTTTCATTTCTATAGGAGGGATGAAGTTGTACACTGAAGATGTATCTGGTGAAGAGAGTGATGGAGAAGAAGAGATGAA
TGATGATGATGATGATGAATCTGGAGATGAAGGAAGCAGTGGATCTTCTGAATTATCTGAGAGTGACAGCTCGGAAGATA
TGTTTGGAAGTTATTCCGAGATTGATGATGATGTTGCCAAGGATTACTTGGAAGGTATTGGTGGCAGTGAGATTATGTTG
GATGCTCATTGGTTAGCAGAACAGTCTTTGGATAAATTAGATTTGTCGAGTGATGATAGTTCTTCAAGCGATTCTTCGGA
TCGAAAAACGAGAAAGTTGACTGGTATTCGTCTGCAAAAAGCTTCAATGGAATATGGTAAGAAGAAGACAACAAGAAGTG
GCTACTCGGGGCATGGTAAGTCTACTAATCCATTGGCAATGGATGATCTTATGTTTGTGAAGGATCCAAGAAGTCTTTCG
GGGAAGAAGAATAAGAAGAAAGAGGTGGCTAAGTTTCCCCAGTCTTGGCCTTCACGGGCACCAAAGAGCAAGAATTCCCG
TAGTTTTCCTGGTGAGAACAAGAAACACCGCAAAGAATACATTGCTTTGAAGCGCCGTGAGAGAATGCTGCAGCGTGGTG
TTGATCTTGCTGATATTAATTCTCAGTTAGAGAATTTTGTTCTGGAGAACGTGGACATGCACTGTTTCCAACGTATGCAT
AATCGAGATTGCTCTCAGGTAAGACGATTAGCAGATGTCTACCGCTTATCAAGTAGCTGCAATGGTTCTGGAAAGAAAAG
CTTTGTGACGGTGACTCGAACATATCAGACATGTATGCCATCTGCCAGCGATAAACTTCGCATTGAGAAGCTAATAGGAG
CTGGAGATGAGGATTGTGATTTTGCTGTCAGTGGAGGGGTAAAAGGGAAATCTGGAAGTTTAGATAGGAAAAAAGCAAAA
GACTCAGCTAAAAAGCGACCTACTAGAGAGGAACGGGAGAGAAACAAAAGCAATGGGAAGAAGAGTTCTTATGCTGATCA
ACCTGTATCATTTGTGTCAAGTGGCATAATCGATTCTGAGATAGCTGTTGCAAAAACCTCAGTTGAAAAAGTTGCAAAAG
AGGTAGCTGAAACTACTCCGGGAACCTCTAATGGAGCAGACATTGGAGCATTTGAGGTACATACCAGAGGTTTTGGATCC
AAAATGATGGCTAAAATGGGATTCATAGATGGAGGTGGTCTAGGAAAGGATGGTAAGGGGATAGCACAGCCAATAGAAGC
TGTTCAGCGTCCGAAATCACTTGGGTTAGGTCTGGATTTCTCCATTGACACTGAAGACCCGAGTCCGTCAAGTAATAACA
ATAACAACGCTAAACGGAACAGATCTTCGTCCTCCGGGAAACATGGGAAACGCATCACCCATGACAATGGTGCCTCTGGT
TCAGGAAGAATCAGGGACAAAAGATTGGGAGCCTTTGAGCAGCACACAACAGGCTTTGGGTCGAGGATGATGGCGAGAAT
GGGTTTCGTCGAAGGCTCGGGTCTGGGTAGAGAGTCACAAGGCATAGTCAATCCGCTGGTCGCTGTCAGACGTCCTAGAG
CACGTGGAATAGGTGCTGAAGGCTAA